PDB entry 5yb0

View 5yb0 on RCSB PDB site
Description: Crystal Structure of Wild Type Phosphoserine aminotransferase (PSAT) from E. histolytica
Class: transferase
Keywords: phosphoserine aminotransferase, transferase
Deposited on 2017-09-02, released 2018-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 2.94 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoserine aminotransferase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EhPSAT, EHI_026360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5yb0a_
  • Chain 'B':
    Compound: phosphoserine aminotransferase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EhPSAT, EHI_026360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5yb0b_
  • Chain 'C':
    Compound: phosphoserine aminotransferase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EhPSAT, EHI_026360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5yb0c_
  • Chain 'D':
    Compound: phosphoserine aminotransferase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EhPSAT, EHI_026360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5yb0d_
  • Chain 'E':
    Compound: phosphoserine aminotransferase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EhPSAT, EHI_026360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5yb0e_
  • Chain 'F':
    Compound: phosphoserine aminotransferase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EhPSAT, EHI_026360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5yb0f_
  • Chain 'G':
    Compound: phosphoserine aminotransferase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EhPSAT, EHI_026360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5yb0g_
  • Chain 'H':
    Compound: phosphoserine aminotransferase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EhPSAT, EHI_026360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5yb0h_
  • Chain 'I':
    Compound: phosphoserine aminotransferase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EhPSAT, EHI_026360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5yb0i_
  • Chain 'J':
    Compound: phosphoserine aminotransferase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EhPSAT, EHI_026360
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: phosphoserine aminotransferase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EhPSAT, EHI_026360
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: phosphoserine aminotransferase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EhPSAT, EHI_026360
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PLP, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yb0A (A:)
    merqnihnfgagpaamakevieatakavnnfweglsileishrskewinvmnetkalmke
    vmdipegyeilffgggaslqflmvamnllnkkacyldtgvwaskaikeaenigevkiigt
    skdknytyipeyqipsdydyfhittnntiygteirkdiespiplvadmssdilskpidis
    kysliyagaqkncgaagvtiviikkeilgkvqrkipiildyqvhilnnsmyntppvisif
    tvnqtlkyikkigglkkiqelneekarllyaeidrnkifrgtvrkkdrsimnvcfvmeeq
    ykqlenefseyalqkgiigikghrsvggfrasiynavtiesvqalikcmhdfeqlhth
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yb0A (A:)
    hnfgagpaamakevieatakavnnfweglsileishrskewinvmnetkalmkevmdipe
    gyeilffgggaslqflmvamnllnkkacyldtgvwaskaikeaenigevkiigtskdkny
    tyipeyqipsdydyfhittnntiygteirkdiespiplvadmssdilskpidiskysliy
    agaqkncgaagvtiviikkeilgkvqrkipiildyqvhilnnsmyntppvisiftvnqtl
    kyikkigglkkiqelneekarllyaeidrnkifrgtvrkkdrsimnvcfvmeeqykqlen
    efseyalqkgiigikghrsvggfrasiynavtiesvqalikcmhdfeq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yb0B (B:)
    merqnihnfgagpaamakevieatakavnnfweglsileishrskewinvmnetkalmke
    vmdipegyeilffgggaslqflmvamnllnkkacyldtgvwaskaikeaenigevkiigt
    skdknytyipeyqipsdydyfhittnntiygteirkdiespiplvadmssdilskpidis
    kysliyagaqkncgaagvtiviikkeilgkvqrkipiildyqvhilnnsmyntppvisif
    tvnqtlkyikkigglkkiqelneekarllyaeidrnkifrgtvrkkdrsimnvcfvmeeq
    ykqlenefseyalqkgiigikghrsvggfrasiynavtiesvqalikcmhdfeqlhth
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yb0B (B:)
    ihnfgagpaamakevieatakavnnfweglsileishrskewinvmnetkalmkevmdip
    egyeilffgggaslqflmvamnllnkkacyldtgvwaskaikeaenigevkiigtskdkn
    ytyipeyqipsdydyfhittnntiygteirkdiespiplvadmssdilskpidiskysli
    yagaqkncgaagvtiviikkeilgkvqrkipiildyqvhilnnsmyntppvisiftvnqt
    lkyikkigglkkiqelneekarllyaeidrnkifrgtvrkkdrsimnvcfvmeeqykqle
    nefseyalqkgiigikghrsvggfrasiynavtiesvqalikcmhdfeq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5yb0C (C:)
    merqnihnfgagpaamakevieatakavnnfweglsileishrskewinvmnetkalmke
    vmdipegyeilffgggaslqflmvamnllnkkacyldtgvwaskaikeaenigevkiigt
    skdknytyipeyqipsdydyfhittnntiygteirkdiespiplvadmssdilskpidis
    kysliyagaqkncgaagvtiviikkeilgkvqrkipiildyqvhilnnsmyntppvisif
    tvnqtlkyikkigglkkiqelneekarllyaeidrnkifrgtvrkkdrsimnvcfvmeeq
    ykqlenefseyalqkgiigikghrsvggfrasiynavtiesvqalikcmhdfeqlhth
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yb0C (C:)
    ihnfgagpaamakevieatakavnnfweglsileishrskewinvmnetkalmkevmdip
    egyeilffgggaslqflmvamnllnkkacyldtgvwaskaikeaenigevkiigtskdkn
    ytyipeyqipsdydyfhittnntiygteirkdiespiplvadmssdilskpidiskysli
    yagaqkncgaagvtiviikkeilgkvqrkipiildyqvhilnnsmyntppvisiftvnqt
    lkyikkigglkkiqelneekarllyaeidrnkifrgtvrkkdrsimnvcfvmeeqykqle
    nefseyalqkgiigikghrsvggfrasiynavtiesvqalikcmhdfeq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5yb0D (D:)
    merqnihnfgagpaamakevieatakavnnfweglsileishrskewinvmnetkalmke
    vmdipegyeilffgggaslqflmvamnllnkkacyldtgvwaskaikeaenigevkiigt
    skdknytyipeyqipsdydyfhittnntiygteirkdiespiplvadmssdilskpidis
    kysliyagaqkncgaagvtiviikkeilgkvqrkipiildyqvhilnnsmyntppvisif
    tvnqtlkyikkigglkkiqelneekarllyaeidrnkifrgtvrkkdrsimnvcfvmeeq
    ykqlenefseyalqkgiigikghrsvggfrasiynavtiesvqalikcmhdfeqlhth
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yb0D (D:)
    ihnfgagpaamakevieatakavnnfweglsileishrskewinvmnetkalmkevmdip
    egyeilffgggaslqflmvamnllnkkacyldtgvwaskaikeaenigevkiigtskdkn
    ytyipeyqipsdydyfhittnntiygteirkdiespiplvadmssdilskpidiskysli
    yagaqkncgaagvtiviikkeilgkvqrkipiildyqvhilnnsmyntppvisiftvnqt
    lkyikkigglkkiqelneekarllyaeidrnkifrgtvrkkdrsimnvcfvykqlenefs
    eyalqkgiigikghrsvggfrasiynavtiesvqalikcmhdfeq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5yb0E (E:)
    merqnihnfgagpaamakevieatakavnnfweglsileishrskewinvmnetkalmke
    vmdipegyeilffgggaslqflmvamnllnkkacyldtgvwaskaikeaenigevkiigt
    skdknytyipeyqipsdydyfhittnntiygteirkdiespiplvadmssdilskpidis
    kysliyagaqkncgaagvtiviikkeilgkvqrkipiildyqvhilnnsmyntppvisif
    tvnqtlkyikkigglkkiqelneekarllyaeidrnkifrgtvrkkdrsimnvcfvmeeq
    ykqlenefseyalqkgiigikghrsvggfrasiynavtiesvqalikcmhdfeqlhth
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yb0E (E:)
    ihnfgagpaamakevieatakavnnfweglsileishrskewinvmnetkalmkevmdip
    egyeilffgggaslqflmvamnllnkkacyldtgvwaskaikeaenigevkiigtskdkn
    ytyipeyqipsdydyfhittnntiygteirkdiespiplvadmssdilskpidiskysli
    yagaqkncgaagvtiviikkeilgkvqrkipiildyqvhilnnsmyntppvisiftvnqt
    lkyikkigglkkiqelneekarllyaeidrnkifrgtvrkkdrsimnvcfvmeenefsey
    alqkgiigikghrsvggfrasiynavtiesvqalikcmhdfe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5yb0F (F:)
    merqnihnfgagpaamakevieatakavnnfweglsileishrskewinvmnetkalmke
    vmdipegyeilffgggaslqflmvamnllnkkacyldtgvwaskaikeaenigevkiigt
    skdknytyipeyqipsdydyfhittnntiygteirkdiespiplvadmssdilskpidis
    kysliyagaqkncgaagvtiviikkeilgkvqrkipiildyqvhilnnsmyntppvisif
    tvnqtlkyikkigglkkiqelneekarllyaeidrnkifrgtvrkkdrsimnvcfvmeeq
    ykqlenefseyalqkgiigikghrsvggfrasiynavtiesvqalikcmhdfeqlhth
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yb0F (F:)
    ihnfgagpaamakevieatakavnnfweglsileishrskewinvmnetkalmkevmdip
    egyeilffgggaslqflmvamnllnkkacyldtgvwaskaikeaenigevkiigtskdkn
    ytyipeyqipsdydyfhittnntiygteirkdiespiplvadmssdilskpidiskysli
    yagaqkncgaagvtiviikkeilgkvqrkipiildyqvhilnnsmyntppvisiftvnqt
    lkyikkigglkkiqelneekarllyaeidrnkifrgtvrkkdrsimnvcfiigikghrsv
    ggfrasiynavtiesvqalikc
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5yb0G (G:)
    merqnihnfgagpaamakevieatakavnnfweglsileishrskewinvmnetkalmke
    vmdipegyeilffgggaslqflmvamnllnkkacyldtgvwaskaikeaenigevkiigt
    skdknytyipeyqipsdydyfhittnntiygteirkdiespiplvadmssdilskpidis
    kysliyagaqkncgaagvtiviikkeilgkvqrkipiildyqvhilnnsmyntppvisif
    tvnqtlkyikkigglkkiqelneekarllyaeidrnkifrgtvrkkdrsimnvcfvmeeq
    ykqlenefseyalqkgiigikghrsvggfrasiynavtiesvqalikcmhdfeqlhth
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yb0G (G:)
    ihnfgagpaamakevieatakavnnfweglsileishrskewinvmnetkalmkevmdip
    egyeilffgggaslqflmvamnllnkkacyldtgvwaskaikeaenigevkiigtskdkn
    ytyipeyqipsdydyfhittnntiygteirkdiespiplvadmssdilskpidiskysli
    yagaqkncgaagvtiviikkeilgkvqrkipiildyqvhilnnsmyntppvisiftvnqt
    lkyikkigglkkiqelneekarllyaeidrnkifrgtvrkkdrsimnvcfvmeeqseyal
    qkgiigikghrsvggfrasiynavtiesvqalikcmhdfeq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5yb0H (H:)
    merqnihnfgagpaamakevieatakavnnfweglsileishrskewinvmnetkalmke
    vmdipegyeilffgggaslqflmvamnllnkkacyldtgvwaskaikeaenigevkiigt
    skdknytyipeyqipsdydyfhittnntiygteirkdiespiplvadmssdilskpidis
    kysliyagaqkncgaagvtiviikkeilgkvqrkipiildyqvhilnnsmyntppvisif
    tvnqtlkyikkigglkkiqelneekarllyaeidrnkifrgtvrkkdrsimnvcfvmeeq
    ykqlenefseyalqkgiigikghrsvggfrasiynavtiesvqalikcmhdfeqlhth
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yb0H (H:)
    ihnfgagpaamakevieatakavnnfweglsileishrskewinvmnetkalmkevmdip
    egyeilffgggaslqflmvamnllnkkacyldtgvwaskaikeaenigevkiigtskdkn
    ytyipeyqipsdydyfhittnntiygteirkdiespiplvadmssdilskpidiskysli
    yagaqkncgaagvtiviikkeilgkvqrkipiildyqvhilnnsmyntppvisiftvnqt
    lkyikkigglkkiqelneekarllyaeidrnkifrgtvrkkdrsimnvcfvmeeqykqle
    nefseyalqkgiigikghrsvggfrasiynavtiesvqalikcmhdfeq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5yb0I (I:)
    merqnihnfgagpaamakevieatakavnnfweglsileishrskewinvmnetkalmke
    vmdipegyeilffgggaslqflmvamnllnkkacyldtgvwaskaikeaenigevkiigt
    skdknytyipeyqipsdydyfhittnntiygteirkdiespiplvadmssdilskpidis
    kysliyagaqkncgaagvtiviikkeilgkvqrkipiildyqvhilnnsmyntppvisif
    tvnqtlkyikkigglkkiqelneekarllyaeidrnkifrgtvrkkdrsimnvcfvmeeq
    ykqlenefseyalqkgiigikghrsvggfrasiynavtiesvqalikcmhdfeqlhth
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yb0I (I:)
    ihnfgagpaamakevieatakavnnfweglsileishrskewinvmnetkalmkevmdip
    egyeilffgggaslqflmvamnllnkkacyldtgvwaskaikeaenigevkiigtskdkn
    ytyipeyqipsdydyfhittnntiygteirkdiespiplvadmssdilskpidiskysli
    yagaqkncgaagvtiviikkeilgkvqrkipiildyqvhilnnsmyntppvisiftvnqt
    lkyikkigglkkiqelneekarllyaeidrnkifrgtvrkkdrsimnvcfseyalqkgii
    gikghrsvggfrasiynavtiesvqalikcmhdfeq
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.