PDB entry 5yav

View 5yav on RCSB PDB site
Description: Fragment-based Drug Discovery of inhibitors to block PDEdelta-RAS protein-protein interaction
Class: oncoprotein
Keywords: PDE6delta, ONCOPROTEIN
Deposited on 2017-09-01, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE6D, PDED
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yavb_
  • Heterogens: 8SF, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yavB (B:)
    msakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavs
    relnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmmpa
    svltgnviietkffdddllvstsrvrlfyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yavB (B:)
    sakderareilrgfklnwmnlrdatgkilwqgtedlsvpgvehearvpkkilkckavsre
    lnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaasqmmpasvlt
    gnviietkffdddllvstsrvrlfyv