PDB entry 5yas

View 5yas on RCSB PDB site
Description: hydroxynitrile lyase complexed with hexafluoroacetone
Class: lyase
Keywords: oxynitrilase, cyanogenesis, cyanohydrin formation, lyase
Deposited on 1999-03-15, released 1999-10-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.187
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hydroxynitrile lyase)
    Species: Hevea brasiliensis [TaxId:3981]
    Gene: HNL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5yasa_
  • Heterogens: SO4, FAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yasA (A:)
    mafahfvlihtichgawiwhklkpllealghkvtaldlaasgvdprqieeigsfdeysep
    lltflealppgekvilvgescgglniaiaadkycekiaaavfhnsvlpdtehcpsyvvdk
    lmevfpdwkdttyftytkdgkeitglklgftllrenlytlcgpeeyelakmltrkgslfq
    nilakrpfftkegygsikkiyvwtdqdeiflpefqlwqienykpdkvykveggdhklqlt
    ktkeiaeilqevadtyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yasA (A:)
    afahfvlihtichgawiwhklkpllealghkvtaldlaasgvdprqieeigsfdeysepl
    ltflealppgekvilvgescgglniaiaadkycekiaaavfhnsvlpdtehcpsyvvdkl
    mevfpdwkdttyftytkdgkeitglklgftllrenlytlcgpeeyelakmltrkgslfqn
    ilakrpfftkegygsikkiyvwtdqdeiflpefqlwqienykpdkvykveggdhklqltk
    tkeiaeilqevadtyn