PDB entry 5yao

View 5yao on RCSB PDB site
Description: The complex structure of SZ529 and expoxid
Class: hydrolase
Keywords: epoxide, stereoselective, mutant, hydrolase
Deposited on 2017-09-01, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: limonene-1,2-epoxide hydrolase
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: limA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZAG3 (Start-154)
      • engineered mutation (37)
      • engineered mutation (83)
      • engineered mutation (85)
      • engineered mutation (119)
    Domains in SCOPe 2.07: d5yaoa_
  • Chain 'B':
    Compound: limonene-1,2-epoxide hydrolase
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: limA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZAG3
      • engineered mutation (37)
      • engineered mutation (83)
      • engineered mutation (119)
    Domains in SCOPe 2.07: d5yaob_
  • Heterogens: 3ZS, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yaoA (A:)
    mhhhhhhtskieqprwaskdsaagaastpdekivlefvdaltsndaaklieyfaedtmyq
    nmplppaygrdaveqtlaglftvvsvdavetfhigssnglvytervdvlralptgksynf
    silgvfqltegkitgwrdyfdlrefeeavdlplrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yaoA (A:)
    kieqprwaskdsaagaastpdekivlefvdaltsndaaklieyfaedtmyqnmplppayg
    rdaveqtlaglftvvsvdavetfhigssnglvytervdvlralptgksynfsilgvfqlt
    egkitgwrdyfdlrefeeavdlplrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yaoB (B:)
    mhhhhhhtskieqprwaskdsaagaastpdekivlefvdaltsndaaklieyfaedtmyq
    nmplppaygrdaveqtlaglftvvsvdavetfhigssnglvytervdvlralptgksynf
    silgvfqltegkitgwrdyfdlrefeeavdlplrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yaoB (B:)
    eqprwaskdsaagaastpdekivlefvdaltsndaaklieyfaedtmyqnmplppaygrd
    aveqtlaglftvvsdavetfhigssnglvytervdvnfsilgvfqltegkitgwrdy