PDB entry 5ya5

View 5ya5 on RCSB PDB site
Description: CRYSTAL STRUCTURE OF c-MET IN COMPLEX WITH NOVEL INHIBITOR
Class: transferase/inhibitor
Keywords: c-MET inhibitor, TRANSFERASE-INHIBITOR complex
Deposited on 2017-08-30, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ya5a_
  • Heterogens: 6TD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ya5A (A:)
    mgsshhhhhhgdsdisspllqntvhidlsalnpelvqavqhvvigpsslivhfnevigrg
    hfgcvyhgtlldndgkkihcavkslnritdigevsqfltegiimkdfshpnvlsllgicl
    rsegsplvvlpymkhgdlrnfirnethnptvkdligfglqvakgmkylaskkfvhrdlaa
    rncmldekftvkvadfglardmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvw
    sfgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemr
    psfselvsrisaifstfig
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ya5A (A:)
    alnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtllkkihcavkslnrsqflte
    giimkdfshpnvlsllgicsplvvlpymkhgdlrnfirnethnptvkdligfglqvakgm
    kylaskkfvhrdlaarncmldekftvkvadfglardmydkeyysvhnktgaklpvkwmal
    eslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdpl
    yevmlkcwhpkaemrpsfselvsrisaifstfi