PDB entry 5ya0

View 5ya0 on RCSB PDB site
Description: Crystal structure of LsrK and HPr complex
Class: structural protein
Keywords: quorum sensing, STRUCTURAL PROTEIN
Deposited on 2017-08-29, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Autoinducer-2 kinase
  Species: Escherichia coli K-12 [TaxId:83333]
  Gene: lsrK, ydeV, b1511, JW1504
  Database cross-references and differences (RAF-indexed):
  • Uniprot P77432
• Chain 'B':
  Compound: Autoinducer-2 kinase
  Species: Escherichia coli K-12 [TaxId:83333]
  Gene: lsrK, ydeV, b1511, JW1504
  Database cross-references and differences (RAF-indexed):
  • Uniprot P77432
• Chain 'C':
  Compound: Phosphocarrier protein HPr
  Species: Escherichia coli K-12 [TaxId:83333]
  Gene: ptsH, hpr, b2415, JW2408
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AA04 (0-84)
  Domains in SCOPe 2.07: d5ya0c_
• Chain 'D':
  Compound: Phosphocarrier protein HPr
  Species: Escherichia coli K-12 [TaxId:83333]
  Gene: ptsH, hpr, b2415, JW2408
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AA04 (0-84)
  Domains in SCOPe 2.07: d5ya0d_
• Heterogens: HEZ, PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5ya0C (C:)
  mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
  vtisaegedeqkavehlvklmaele
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5ya0D (D:)
  mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
  vtisaegedeqkavehlvklmaele