PDB entry 5ya0

View 5ya0 on RCSB PDB site
Description: Crystal structure of LsrK and HPr complex
Class: structural protein
Keywords: quorum sensing, STRUCTURAL PROTEIN
Deposited on 2017-08-29, released 2018-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Autoinducer-2 kinase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: lsrK, ydeV, b1511, JW1504
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Autoinducer-2 kinase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: lsrK, ydeV, b1511, JW1504
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Phosphocarrier protein HPr
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: ptsH, hpr, b2415, JW2408
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5ya0c_
  • Chain 'D':
    Compound: Phosphocarrier protein HPr
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: ptsH, hpr, b2415, JW2408
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5ya0d_
  • Heterogens: HEZ, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ya0C (C:)
    mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
    vtisaegedeqkavehlvklmaele
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ya0D (D:)
    mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
    vtisaegedeqkavehlvklmaele