PDB entry 5y9m

View 5y9m on RCSB PDB site
Description: Crystal structure of CK2a2 form 3
Class: transferase
Keywords: protein kinase, transferase
Deposited on 2017-08-25, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase II subunit alpha'
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK2A2, CK2A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y9ma_
  • Chain 'X':
    Compound: Casein kinase II subunit alpha'
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK2A2, CK2A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y9mx_
  • Heterogens: NIO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y9mA (A:)
    gplgsmpgpaagsrarvyaevnslrsreywdyeahvpswgnqddyqlvrklgrgkysevf
    eainitnnervvvkilkpvkkkkikrevkilenlrggtniiklidtvkdpvsktpalvfe
    yinntdfkqlyqiltdfdirfymyellkaldychskgimhrdvkphnvmidhqqkklrli
    dwglaefyhpaqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrrepffh
    gqdnydqlvriakvlgteelygylkkyhidldphfndilgqhsrkrwenfihsenrhlvs
    pealdlldkllrydhqqrltakeamehpyfypvvkeqsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y9mA (A:)
    gsrarvyaevnslrsreywdyeahvpswgnqddyqlvrklgysevfeainitnnervvvk
    ilkpvkkkkikrevkilenlrggtniiklidtvkdpvsktpalvfeyinntdfkqlyqil
    tdfdirfymyellkaldychskgimhrdvkphnvmidhqqkklrlidwglaefyhpaqey
    nvrvasryfkgpellvdyqmydysldmwslgcmlasmifrrepffhgqdnydqlvriakv
    lgteelygylkkyhidldphfndilgqhsrkrwenfihsenrhlvspealdlldkllryd
    hqqrltakeamehpyfypvv
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >5y9mX (X:)
    gplgsmpgpaagsrarvyaevnslrsreywdyeahvpswgnqddyqlvrklgrgkysevf
    eainitnnervvvkilkpvkkkkikrevkilenlrggtniiklidtvkdpvsktpalvfe
    yinntdfkqlyqiltdfdirfymyellkaldychskgimhrdvkphnvmidhqqkklrli
    dwglaefyhpaqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrrepffh
    gqdnydqlvriakvlgteelygylkkyhidldphfndilgqhsrkrwenfihsenrhlvs
    pealdlldkllrydhqqrltakeamehpyfypvvkeqsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y9mX (X:)
    gsrarvyaevnslrsreywdyeahvpswgnqddyqlvrklgsevfeainitnnervvvki
    lkpvkkkkikrevkilenlrggtniiklidtvkdpvsktpalvfeyinntdfkqlyqilt
    dfdirfymyellkaldychskgimhrdvkphnvmidhqqkklrlidwglaefyhpaqeyn
    vrvasryfkgpellvdyqmydysldmwslgcmlasmifrrepffhgqdnydqlvriakvl
    gteelygylkkyhidldphfndilgqhsrkrwenfihsenrhlvspealdlldkllrydh
    qqrltakeamehpyfypvv