PDB entry 5y97

View 5y97 on RCSB PDB site
Description: Crystal structure of snake gourd seed lectin in complex with lactose
Class: plant protein
Keywords: beta-trefoil, Lectin, PLANT PROTEIN
Deposited on 2017-08-23, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: seed lectin
  Species: Trichosanthes anguina [TaxId:50544]
  Database cross-references and differences (RAF-indexed):
  • Uniprot U3KRF8 (0-40)
• Chain 'B':
  Compound: seed lectin
  Species: Trichosanthes anguina [TaxId:50544]
  Database cross-references and differences (RAF-indexed):
  • Uniprot U3KRF8
• Chain 'C':
  Compound: seed lectin
  Species: Trichosanthes anguina [TaxId:50544]
  Database cross-references and differences (RAF-indexed):
  • Uniprot U3KRF8 (0-263)
  Domains in SCOPe 2.07: d5y97c1, d5y97c2
• Heterogens: LAT, NAG, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5y97C (C:)
  neclvetrttrisgrdalcvdvagaltsdgsrlilypcgqqvnqkwtfhsdgtvrslgkc
  latnnskfgnlvviydcsklaaediswdvsvggtimnpnyedlaltsnkatrstnltmev
  ntysasqgwrvgnyvqpiigsivglddmcleatdgntnmwleecvpnqreqswalysdgt
  irvddnrelcvtassstydnwkvitilncdgsnnqrwvfladgsistpgnqrlamdvars
  dvdlkkiilhrphgdlnqqwvlfy