PDB entry 5y97

View 5y97 on RCSB PDB site
Description: Crystal structure of snake gourd seed lectin in complex with lactose
Class: plant protein
Keywords: beta-trefoil, Lectin, PLANT PROTEIN
Deposited on 2017-08-23, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: seed lectin
    Species: Trichosanthes anguina [TaxId:50544]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: seed lectin
    Species: Trichosanthes anguina [TaxId:50544]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: seed lectin
    Species: Trichosanthes anguina [TaxId:50544]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y97c1, d5y97c2
  • Heterogens: LAT, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5y97C (C:)
    neclvetrttrisgrdalcvdvagaltsdgsrlilypcgqqvnqkwtfhsdgtvrslgkc
    latnnskfgnlvviydcsklaaediswdvsvggtimnpnyedlaltsnkatrstnltmev
    ntysasqgwrvgnyvqpiigsivglddmcleatdgntnmwleecvpnqreqswalysdgt
    irvddnrelcvtassstydnwkvitilncdgsnnqrwvfladgsistpgnqrlamdvars
    dvdlkkiilhrphgdlnqqwvlfy