PDB entry 5y8r

View 5y8r on RCSB PDB site
Description: ZsYellow at pH 3.5
Class: fluorescent protein
Keywords: ZsYellow, pH, FLUORESCENT PROTEIN
Deposited on 2017-08-21, released 2017-09-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GFP-like fluorescent chromoprotein FP538
    Species: Zoanthus sp. [TaxId:105402]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U6Y4 (Start-233)
      • chromophore (68)
      • engineered mutation (131)
    Domains in SCOPe 2.06: d5y8ra_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y8rA (A:)
    gshmahskhglkeemtmkyhmegcvnghkfvitgegigypfkgkqtinlcvieggplpfs
    edilsagfkygdrifteypqdivdyfknscpagytwgrsflfedgavcicnvditvsvke
    nciyhksifngvnfpadgpvmkkmttnweascekimpvpkqgilkgdvsmylllkdggry
    rcqfdtvykaksvpskmpewhfiqhkllredrsdaknqkwqltehaiafpsala
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y8rA (A:)
    khglkeemtmkyhmegcvnghkfvitgegigypfkgkqtinlcvieggplpfsedilsag
    fkygdrifteypqdivdyfknscpagytwgrsflfedgavcicnvditvsvkenciyhks
    ifngvnfpadgpvmkkmttnweascekimpvpkqgilkgdvsmylllkdggryrcqfdtv
    ykaksvpskmpewhfiqhkllredraknqkwqltehaiafpsala