PDB entry 5y8l

View 5y8l on RCSB PDB site
Description: Mycobacterium tuberculosis 3-Hydroxyisobutyrate dehydrogenase (MtHIBADH) + NAD +(S)-3-hydroxyisobutyrate (S-HIBA)
Class: oxidoreductase
Keywords: 3-Hydroxy acid Dehydrogenase, Enzyme substrate interactions, Mechanism of enzyme action, OXIDOREDUCTASE
Deposited on 2017-08-21, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable 3-hydroxyisobutyrate dehydrogenase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: mmsB, Rv0751c, MTV041.25c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y8la1, d5y8la2
  • Chain 'B':
    Compound: Probable 3-hydroxyisobutyrate dehydrogenase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: mmsB, Rv0751c, MTV041.25c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WNY5 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d5y8lb1, d5y8lb2, d5y8lb3
  • Heterogens: NAD, GOL, 9ON, HUI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y8lA (A:)
    mmttiaflglgnmgapmsanlvgaghvvrgfdpaptaasgaaahgvavfrsapeavaead
    vvitmlptgevvrrcytdvlaaarpatlfidsstisvtdarevhalaeshgmlqldapvs
    ggvkgaaaatlafmvggdestlrrarpvlepmagkiihcgaagagqaakvcnnmvlavqq
    iaiaeafvlaeklglsaqslfdvitgatgncwavhtncpvpgpvptspanndfkpgfsta
    lmnkdlglamdavaatgataplgshaadiyakfaadhadldfsavihtlrarada
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y8lA (A:)
    mttiaflglgnmgapmsanlvgaghvvrgfdpaptaasgaaahgvavfrsapeavaeadv
    vitmlptgevvrrcytdvlaaarpatlfidsstisvtdarevhalaeshgmlqldapvsg
    gvkgaaaatlafmvggdestlrrarpvlepmagkiihcgaagagqaakvcnnmvlavqqi
    aiaeafvlaeklglsaqslfdvitgatgncwavhtncpvpgpvptspanndfkpgfstal
    mnkdlglamdavaatgataplgshaadiyakfaadhadldfsavihtlrara
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5y8lB (B:)
    mmttiaflglgnmgapmsanlvgaghvvrgfdpaptaasgaaahgvavfrsapeavaead
    vvitmlptgevvrrcytdvlaaarpatlfidsstisvtdarevhalaeshgmlqldapvs
    ggvkgaaaatlafmvggdestlrrarpvlepmagkiihcgaagagqaakvcnnmvlavqq
    iaiaeafvlaeklglsaqslfdvitgatgncwavhtncpvpgpvptspanndfkpgfsta
    lmnkdlglamdavaatgataplgshaadiyakfaadhadldfsavihtlrarada
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y8lB (B:)
    mmttiaflglgnmgapmsanlvgaghvvrgfdpaptaasgaaahgvavfrsapeavaead
    vvitmlptgevvrrcytdvlaaarpatlfidsstisvtdarevhalaeshgmlqldapvs
    ggvkgaaaatlafmvggdestlrrarpvlepmagkiihcgaagagqaakvcnnmvlavqq
    iaiaeafvlaeklglsaqslfdvitgatgncwavhtncpvpgpvptspanndfkpgfsta
    lmnkdlglamdavaatgataplgshaadiyakfaadhadldfsavihtlra