PDB entry 5y80

View 5y80 on RCSB PDB site
Description: Complex structure of cyclin G-associated kinase with gefitinib
Class: transferase/immune system
Keywords: kinase, complex, TRANSFERASE-IMMUNE SYSTEM complex
Deposited on 2017-08-18, released 2018-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-g-associated kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: GAK
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14976 (2-End)
      • expression tag (1)
  • Chain 'B':
    Compound: Nanobody
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5Y80
    Domains in SCOPe 2.08: d5y80b1, d5y80b2
  • Heterogens: IRE, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >5y80B (B:)
gssgssgqvqlqesggglvqpggslrlscsasgfkfndsymswvrrvpgkglewvagiwe
dssaahyrdsvkgrftisrdnaknmlylqmsslksddtglyycvrrgysgdyrpinnpss
qgtqvtvssaaaypydvpdygshhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >5y80B (B:)
gqvqlqesggglvqpggslrlscsasgfkfndsymswvrrvpgkglewvagiwedssaah
yrdsvkgrftisrdnaknmlylqmsslksddtglyycvrrgysgdyrpinnpssqgtqvt
vssa