PDB entry 5y7x

View 5y7x on RCSB PDB site
Description: Human Peroxisome proliferator-activated receptor (PPAR) delta in complexed with a potent and selective agonist
Class: protein binding
Keywords: peroxisome proliferator-activated receptor, selenazole, diabetes, pi-sulfur interaction., PROTEIN BINDING
Deposited on 2017-08-18, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARD, NR1C2, PPARB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y7xa_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARD, NR1C2, PPARB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y7xb_
  • Heterogens: 8RR, K, CL, PGO, JZR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y7xA (A:)
    mgsshhhhhhssglvprgshmqvadlkafskhiynaylknfnmtkkkarsiltgkashta
    pfvihdietlwqaekglvwkqlvnglppykeisvhvfyrcqcttvetvreltefaksips
    fsslflndqvtllkygvheaifamlasivnkdgllvangsgfvtreflrslrkpfsdiie
    pkfefavkfnalelddsdlalfiaaiilcgdrpglmnvprveaiqdtilralefhlqanh
    pdaqylfpkllqkmadlrqlvtehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y7xA (A:)
    adlkafskhiynaylknfnmtkkkarsiltghtapfvihdietlwqaekglvwlppykei
    svhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivnkd
    gllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdr
    pglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmqrik
    ktetetslhpllqeiykd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5y7xB (B:)
    mgsshhhhhhssglvprgshmqvadlkafskhiynaylknfnmtkkkarsiltgkashta
    pfvihdietlwqaekglvwkqlvnglppykeisvhvfyrcqcttvetvreltefaksips
    fsslflndqvtllkygvheaifamlasivnkdgllvangsgfvtreflrslrkpfsdiie
    pkfefavkfnalelddsdlalfiaaiilcgdrpglmnvprveaiqdtilralefhlqanh
    pdaqylfpkllqkmadlrqlvtehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y7xB (B:)
    adlkafskhiynaylknfnmtkkkarsiltgkatapfvihdietlwqaekglvwglppyk
    eisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivn
    kdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcg
    drpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmqr
    ikktetetslhpllqeiykdmy