PDB entry 5y7j

View 5y7j on RCSB PDB site
Description: Crystal structure of human DPP4 in complex with inhibitor2
Class: hydrolase
Keywords: DPP4, inhibitor, HYDROLASE
Deposited on 2017-08-17, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y7ja1, d5y7ja2
  • Chain 'B':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y7jb1, d5y7jb2
  • Chain 'C':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y7jc1, d5y7jc2
  • Chain 'D':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y7jd1, d5y7jd2
  • Heterogens: 8OL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y7jA (A:)
    srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
    ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
    pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
    vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
    clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
    kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
    vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfii
    lnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsm
    vlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshf
    ikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y7jA (A:)
    rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
    hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
    vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
    gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
    tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
    lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
    gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
    sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiil
    netkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfd
    grgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmv
    lgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqve
    yllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfi
    kqcfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5y7jB (B:)
    srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
    ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
    pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
    vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
    clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
    kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
    vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfii
    lnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsm
    vlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshf
    ikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y7jB (B:)
    rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
    hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
    vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
    gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
    tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
    lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
    gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
    sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiil
    netkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfd
    grgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmv
    lgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqve
    yllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfi
    kqcfslp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5y7jC (C:)
    srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
    ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
    pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
    vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
    clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
    kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
    vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfii
    lnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsm
    vlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshf
    ikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y7jC (C:)
    rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
    hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
    vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
    gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
    tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
    lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
    gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
    sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiil
    netkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfd
    grgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmv
    lgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqve
    yllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfi
    kqcfs
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5y7jD (D:)
    srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
    ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
    pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
    vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
    clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
    kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
    vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfii
    lnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsm
    vlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshf
    ikqcfslp