PDB entry 5y7i

View 5y7i on RCSB PDB site
Description: Structure of tilapia fish CLIC2
Class: transport protein
Keywords: Glutathione S-transferase structural superfamily, Chloride channel activity, TRANSPORT PROTEIN
Deposited on 2017-08-17, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chloride intracellular channel protein 2
    Species: Oreochromis mossambicus [TaxId:8127]
    Gene: chloride intracellular channel protein 2
    Database cross-references and differences (RAF-indexed):
    • PDB 5Y7I
    Domains in SCOPe 2.07: d5y7ia1, d5y7ia2
  • Chain 'B':
    Compound: Chloride intracellular channel protein 2
    Species: Oreochromis mossambicus [TaxId:8127]
    Gene: chloride intracellular channel protein 2
    Database cross-references and differences (RAF-indexed):
    • PDB 5Y7I
    Domains in SCOPe 2.07: d5y7ib1, d5y7ib2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y7iA (A:)
    mhhhhhhssglvprgsmaalrqssdkepsielfikaghdgenvgncpfcqrlfmvlwlkg
    vkftvttvdmrkkpaelkdlapgtnppfllyngtlktdfikieefleqtlappryphlsp
    vnkesfdvgadifakfsafiknspnnplqeknllrefkrlddylnsplpeeidhnsveti
    tvsnrkfldgdrltladcnllpklhvirvaakkycnfeipdhftgvwrylknaderdefk
    qtcpadieiekaylsvankrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y7iA (A:)
    dkepsielfikaghdgenvgncpfcqrlfmvlwlkgvkftvttvdmrkkpaelkdlapgt
    nppfllyngtlktdfikieefleqtlappryphlspvnkesfdvgadifakfsafiknsp
    nnplqeknllrefkrlddylnsplpeeidhnsvetitvsnrkfldgdrltladcnllpkl
    hvirvaakkycnfeipdhftgvwrylknaderdefkqtcpadieiekaylsvan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5y7iB (B:)
    mhhhhhhssglvprgsmaalrqssdkepsielfikaghdgenvgncpfcqrlfmvlwlkg
    vkftvttvdmrkkpaelkdlapgtnppfllyngtlktdfikieefleqtlappryphlsp
    vnkesfdvgadifakfsafiknspnnplqeknllrefkrlddylnsplpeeidhnsveti
    tvsnrkfldgdrltladcnllpklhvirvaakkycnfeipdhftgvwrylknaderdefk
    qtcpadieiekaylsvankrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y7iB (B:)
    dkepsielfikaghdgenvgncpfcqrlfmvlwlkgvkftvttvdmrkkpaelkdlapgt
    nppfllyngtlktdfikieefleqtlappryphlspvnkesfdvgadifakfsafiknsp
    nnplqeknllrefkrlddylnsplpeeidhnsvetitvsnrkfldgdrltladcnllpkl
    hvirvaakkycnfeipdhftgvwrylknaderdefkqtcpadieiekaylsvankr