PDB entry 5y6u

View 5y6u on RCSB PDB site
Description: Crystal structure of wild-type YabJ protein from Bacillus subtilis (natto).
Class: unknown function
Keywords: Homotrimer, UNKNOWN FUNCTION
Deposited on 2017-08-15, released 2018-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: YabJ protein
    Species: Bacillus subtilis subsp. natto (strain BEST195) [TaxId:645657]
    Gene: yabJ, BSNT_00084
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y6ua_
  • Chain 'B':
    Compound: YabJ protein
    Species: Bacillus subtilis subsp. natto (strain BEST195) [TaxId:645657]
    Gene: yabJ, BSNT_00084
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y6ub_
  • Chain 'C':
    Compound: YabJ protein
    Species: Bacillus subtilis subsp. natto (strain BEST195) [TaxId:645657]
    Gene: yabJ, BSNT_00084
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y6uc_
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y6uA (A:)
    mtkavhtkhapaaigpysqgiivnnmfyssgqipltpsgemvngdikeqthqvfsnlkav
    leeagasfetvvkatvfiadmeqfaevnevygqyfdthkparscvevarlpkdalveiev
    ialvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y6uA (A:)
    tkavhtkhapaaigpysqgiivnnmfyssgqipltpsgemvngdikeqthqvfsnlkavl
    eeagasfetvvkatvfiadmeqfaevnevygqyfdthkparscvevarlpkdalveievi
    alvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5y6uB (B:)
    mtkavhtkhapaaigpysqgiivnnmfyssgqipltpsgemvngdikeqthqvfsnlkav
    leeagasfetvvkatvfiadmeqfaevnevygqyfdthkparscvevarlpkdalveiev
    ialvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y6uB (B:)
    tkavhtkhapaaigpysqgiivnnmfyssgqipltpsgemvngdikeqthqvfsnlkavl
    eeagasfetvvkatvfiadmeqfaevnevygqyfdthkparscvevarlpkdalveievi
    alvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5y6uC (C:)
    mtkavhtkhapaaigpysqgiivnnmfyssgqipltpsgemvngdikeqthqvfsnlkav
    leeagasfetvvkatvfiadmeqfaevnevygqyfdthkparscvevarlpkdalveiev
    ialvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y6uC (C:)
    tkavhtkhapaaigpysqgiivnnmfyssgqipltpsgemvngdikeqthqvfsnlkavl
    eeagasfetvvkatvfiadmeqfaevnevygqyfdthkparscvevarlpkdalveievi
    alvk