PDB entry 5y6t

View 5y6t on RCSB PDB site
Description: Crystal structure of endo-1,4-beta-mannanase from Eisenia fetida
Class: carbohydrate
Keywords: cold adaptation, GH5 family, CARBOHYDRATE
Deposited on 2017-08-15, released 2018-06-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.7000000000000002 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-mannanase
    Species: Eisenia fetida [TaxId:6396]
    Database cross-references and differences (RAF-indexed):
    • PDB 5Y6T
    Domains in SCOPe 2.08: d5y6ta_
  • Heterogens: TRS, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y6tA (A:)
    eafeqqfldvqngqlrlngekvfmsgmniawqnygrdfgngqydcctgnaledyivrika
    eggnslriwvhcdggytpefdgngyvvgtdaqntmtsdlaqfldvayannvlvfivlwng
    attptsryrdliyddsklqtyidqalvpmvsalsgkvalggwevmnepegivsagvsdgn
    pcfdtqplagsgagwadsipmqrlqsfinkqtaaikradpkvivtlgswseraqtdqfgw
    rnyytdnclidaggdslgvidfyqmhtyawegaytssspllvpnsqynldkpnnigefsq
    sggdgrsitdqfdwaytqgycgawswqangggdnadsfatqaqglnhlrgrndqnaggri
    diilqleqkliseedlnsavdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y6tA (A:)
    qqfldvqngqlrlngekvfmsgmniawqnygrdfgngqydcctgnaledyivrikaeggn
    slriwvhcdggytpefdgngyvvgtdaqntmtsdlaqfldvayannvlvfivlwngattp
    tsryrdliyddsklqtyidqalvpmvsalsgkvalggwevmnepegivsagvsdgnpcfd
    tqplagsgagwadsipmqrlqsfinkqtaaikradpkvivtlgswseraqtdqfgwrnyy
    tdnclidaggdslgvidfyqmhtyawegaytssspllvpnsqynldkpnnigefsqsggd
    grsitdqfdwaytqgycgawswqangggdnadsfatqaqglnhlrgrndqnaggridiil
    q