PDB entry 5y6q

View 5y6q on RCSB PDB site
Description: Crystal structure of an aldehyde oxidase from Methylobacillus sp. KY4400
Class: oxidoreductase
Keywords: aldehyde oxidase molybdenum enzyme Methylobacillus sp. KY4400, OXIDOREDUCTASE
Deposited on 2017-08-13, released 2018-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldehyde oxidase small subunit
    Species: Methylobacillus sp. KY4400 [TaxId:194289]
    Gene: aoms
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84IY0
      • see sequence details (30)
    Domains in SCOPe 2.07: d5y6qa1, d5y6qa2
  • Chain 'B':
    Compound: Aldehyde oxidase medium subunit
    Species: Methylobacillus sp. KY4400 [TaxId:194289]
    Gene: aomm
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84IX9 (0-329)
      • see sequence details (194)
      • see sequence details (238)
      • see sequence details (261)
      • see sequence details (269)
      • see sequence details (292-293)
  • Chain 'C':
    Compound: Aldehyde oxidase large subunit
    Species: Methylobacillus sp. KY4400 [TaxId:194289]
    Gene: aoml
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FES, SO4, FAD, SF4, GOL, MOS, MCN, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y6qA (A:)
    mserisltmqvngqpypmeidprvtlldalrehlnltgtkkgcdqgqcgactvlvngqrv
    lscltlaaqadgaevtsieglqsasgelhpvqrcfvendafqcgyctpgqimsavacike
    ghagsddeireymsgnlcrcgayphiidaikqaaaemakesa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y6qA (A:)
    erisltmqvngqpypmeidprvtlldalrehlnltgtkkgcdqgqcgactvlvngqrvls
    cltlaaqadgaevtsieglqsasgelhpvqrcfvendafqcgyctpgqimsavacikegh
    agsddeireymsgnlcrcgayphiidaikqaaaemak
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.