PDB entry 5y6m

View 5y6m on RCSB PDB site
Description: Zika virus helicase in complex with ADP-AlF3
Class: hydrolase
Keywords: zika viral helicase, hydrolysis, HYDROLASE
Deposited on 2017-08-12, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Helicase domain from Genome polyprotein
    Species: Zika virus (strain Mr 766) [TaxId:64320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y6ma1, d5y6ma2
  • Heterogens: MN, ADP, AF3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y6mA (A:)
    epsmlkkkqltvldlhpgagktrrvlpeivreaiktrlrtvilaptrvvaaemeealrgl
    pvrymttavnvthsgteivdlmchatftsrllqpirvpnynlyimdeahftdpssiaarg
    yistrvemgeaaaifmtatppgtrdafpdsnspimdtevevperawssgfdwvtdhsgkt
    vwfvpsvrngneiaacltkagkrviqlsrktfetefqktkhqewdfvvttdisemganfk
    adrvidsrrclkpvildgervilagpmpvthasaaqrrgrigrnpnkpgdeylygggcae
    tdedhahwlearmlldniylqdgliaslyrpeadkvaaiegefklrteqrktfvelmkrg
    dlpvwlayqvasagitytdrrwcfdgttnntimedsvpaevwtrhgekrvlkprwmdarv
    csdhaalksfkefaagkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y6mA (A:)
    mlkkkqltvldlhpgagktrrvlpeivreaiktrlrtvilaptrvvaaemeealrglpvr
    ymttnvthsgteivdlmchatftsrllqpirvpnynlyimdeahftdpssiaargyistr
    vemgeaaaifmtatppgtrdafpdsnspimdtevevperawssgfdwvtdhsgktvwfvp
    svrngneiaacltkagkrviqlsrktfetefqktkhqewdfvvttdisemganfkadrvi
    dsrrclkpvildgervilagpmpvthasaaqrrgrigrnpnkpgdeylygggcaetdedh
    ahwlearmlldniylqdgliaslyrpeadkvaaiegefklrteqrktfvelmkrgdlpvw
    layqvasagitytdrrwcfdgttnntimedsvpaevwtrhgekrvlkprwmdarvcsdha
    alksfkefaagkr