PDB entry 5y5u

View 5y5u on RCSB PDB site
Description: Crystal structures of spleen tyrosine kinase in complex with a novel inhibitor
Class: transferase/transferase inhibitor
Keywords: Inhibitor, Spleen Tyrosine Kinase, human kinase, drug discovery, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2017-08-09, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5ua_
  • Chain 'B':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5ub_
  • Heterogens: 8OU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y5uA (A:)
    maleeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpa
    lkdellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdknii
    elvhqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthg
    kwpvkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermg
    cpagcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvnlehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5uA (A:)
    yldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkpalkdellaeanvmqqld
    npyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkylees
    nfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapecinyyk
    fssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlc
    wtydvenrpgfaavelrlrnyyydvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5y5uB (B:)
    maleeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpa
    lkdellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdknii
    elvhqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthg
    kwpvkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermg
    cpagcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvnlehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5uB (B:)
    vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilknpalkdellaeanvmqq
    ldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyle
    esnfvhrdlaarnvllvtqhyakisdfglskalradenyykapvkwyapecinyykfssk
    sdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwtyd
    venrpgfaavelrlrny