PDB entry 5y5s

View 5y5s on RCSB PDB site
Description: Structure of photosynthetic LH1-RC super-complex at 1.9 angstrom resolution
Class: photosynthesis
Keywords: LH1-RC, photosynthesis, purple bacteria
Deposited on 2017-08-09, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5s0_
  • Chain '1':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5s1_
  • Chain '2':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5s2_
  • Chain '3':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5s3_
  • Chain '4':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5s4_
  • Chain '5':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5s5_
  • Chain '6':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5s6_
  • Chain '7':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5s7_
  • Chain '8':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5s8_
  • Chain '9':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5s9_
  • Chain 'A':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5sa_
  • Chain 'B':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5sb_
  • Chain 'C':
    Compound: Photosynthetic reaction center cytochrome c subunit
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5sc_
  • Chain 'D':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5sd_
  • Chain 'E':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5se_
  • Chain 'F':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5sf_
  • Chain 'G':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5sg_
  • Chain 'H':
    Compound: Photosynthetic reaction center H subunit
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5sh1, d5y5sh2
  • Chain 'I':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5si_
  • Chain 'J':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5sj_
  • Chain 'K':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5sk_
  • Chain 'L':
    Compound: Photosynthetic reaction center L subunit
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Photosynthetic reaction center M subunit
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5sm_
  • Chain 'N':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5sn_
  • Chain 'O':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5so_
  • Chain 'P':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5sp_
  • Chain 'Q':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5sq_
  • Chain 'R':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5sr_
  • Chain 'S':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5ss_
  • Chain 'T':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5st_
  • Chain 'U':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5su_
  • Chain 'V':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5sv_
  • Chain 'W':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5sw_
  • Chain 'X':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5sx_
  • Chain 'Y':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5sy_
  • Chain 'Z':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5sz_
  • Heterogens: HEM, MG, GOL, SO4, LHG, PGV, BCL, BPH, UQ8, UNL, FE, MQ8, CRT, PEF, LDA, CDL, LMT, CA, HOH

PDB Chain Sequences:

  • Chain '0':
    Sequence, based on SEQRES records: (download)
    >5y5s0 (0:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5s0 (0:)
    ksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >5y5s1 (1:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5s1 (1:)
    mnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalg
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >5y5s2 (2:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5s2 (2:)
    ltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >5y5s3 (3:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5s3 (3:)
    mnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalg
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >5y5s4 (4:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5s4 (4:)
    sltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain '5':
    Sequence, based on SEQRES records: (download)
    >5y5s5 (5:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5s5 (5:)
    anlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalg
    

  • Chain '6':
    Sequence, based on SEQRES records: (download)
    >5y5s6 (6:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5s6 (6:)
    sltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain '7':
    Sequence, based on SEQRES records: (download)
    >5y5s7 (7:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5s7 (7:)
    tmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalg
    

  • Chain '8':
    Sequence, based on SEQRES records: (download)
    >5y5s8 (8:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5s8 (8:)
    ltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain '9':
    Sequence, based on SEQRES records: (download)
    >5y5s9 (9:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5s9 (9:)
    tmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalg
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y5sA (A:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5sA (A:)
    anlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5y5sB (B:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5sB (B:)
    sltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5y5sC (C:)
    mspaqqltlpavivvasvmllgcegpppgteqigyrgvgmenyynkrqralsiqanqpve
    slpaadstgpkasevyqnvqvlkdlsvgeftrtmvavttwvspkegcnychvpgnwasdd
    iytkvvsrrmfelvraansdwkahvaetgvtcytchrgnpvpkyawvtdpgpkypsglkp
    tgqnygsktvayaslpfdpltpfldqaneiritgnaalagsnpaslkqaewtfglmmnis
    dslgvgctfchntrafndwtqstpkrttawyairhvrdinqnyiwplndvlpasrkgpyg
    dplrvscmtchqavnkplygaqmakdypglyktavtqealagsapaseaapaaateaape
    apaqevpaaeavpaaaepgaaeaagsvepapveevapapaaqrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5sC (C:)
    cegpppgteqigyrgvgmenyynkrqralsiqanqpveslpaadstgpkasevyqnvqvl
    kdlsvgeftrtmvavttwvspkegcnychvpgnwasddiytkvvsrrmfelvraansdwk
    ahvaetgvtcytchrgnpvpkyawvtdpgpkypsglkptgqnygsktvayaslpfdpltp
    fldqaneiritgnaalagsnpaslkqaewtfglmmnisdslgvgctfchntrafndwtqs
    tpkrttawyairhvrdinqnyiwplndvlpasrkgpygdplrvscmtchqavnkplygaq
    makdypglykt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5y5sD (D:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5sD (D:)
    nanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5y5sE (E:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5sE (E:)
    ltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5y5sF (F:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5sF (F:)
    nanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5y5sG (G:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5sG (G:)
    sltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5y5sH (H:)
    msagithyidaaqitiwafwlfffgliiylrredkregypldsdrtersggrvkvvgfpd
    lpdpktfvlphnggtvvaprveapvavnatpfspapgsplvpngdpmlsgfgpaaspdrp
    khcdltfeglpkivpmrvakefsiaegdpdprgmtvvgldgevagtvsdvwvdrsepqir
    ylevevaankkkvllpigfsrfdkkarkvkvdaikaahfanvptlsnpdqvtlyeedkvc
    ayyaggklyataeragpll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5sH (H:)
    ithyidaaqitiwafwlfffgliiylrredkregypldsdrtersggrvkvvgfpdlpdp
    ktfvlphnggtvvaprveapvavnatpfspapgsplvpngdpmlsgfgpaaspdrpkhcd
    ltfeglpkivpmrvakefsiaegdpdprgmtvvgldgevagtvsdvwvdrsepqirylev
    evaankkkvllpigfsrfdkkarkvkvdaikaahfanvptlsnpdqvtlyeedkvcayya
    ggklyataeragpll
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5y5sI (I:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5sI (I:)
    tmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5y5sJ (J:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5sJ (J:)
    sltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5y5sK (K:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5sK (K:)
    tmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalg
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5y5sM (M:)
    mpeyqniftavqvrapaypgvplpkgnlprigrpifsywlgkigdaqigpiylgltgtls
    iffglvaisiigfnmlasvhwdvfqflkhffwlgleppppqyglripplseggwwlmagl
    fltlsillwwvrtykraealgmsqhlswafaaaiffylvlgfirpvmmgswakavpfgif
    phldwtaafsirygnlyynpfhmlsiaflygsallfamhgatilsvsrfggdreidqith
    rgtaaeraalfwrwtmgfnvtmesihrwawwcavltvitagigillsgtvvdnwylwavk
    hgmapaypevvtavnpyetaaevmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5sM (M:)
    peyqniftavqvrapaypgvplpkgnlprigrpifsywlgkigdaqigpiylgltgtlsi
    ffglvaisiigfnmlasvhwdvfqflkhffwlgleppppqyglripplseggwwlmaglf
    ltlsillwwvrtykraealgmsqhlswafaaaiffylvlgfirpvmmgswakavpfgifp
    hldwtaafsirygnlyynpfhmlsiaflygsallfamhgatilsvsrfggdreidqithr
    gtaaeraalfwrwtmgfnvtmesihrwawwcavltvitagigillsgtvvdnwylwavkh
    gmapaypevvtavnpyet
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5y5sN (N:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5sN (N:)
    sltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5y5sO (O:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5sO (O:)
    mnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalg
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5y5sP (P:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5sP (P:)
    sltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >5y5sQ (Q:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5sQ (Q:)
    tmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalg
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >5y5sR (R:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5sR (R:)
    ltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >5y5sS (S:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5sS (S:)
    tmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqal
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >5y5sT (T:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5sT (T:)
    ksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >5y5sU (U:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5sU (U:)
    tmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >5y5sV (V:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5sV (V:)
    sltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >5y5sW (W:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5sW (W:)
    nanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >5y5sX (X:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5sX (X:)
    ltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >5y5sY (Y:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5sY (Y:)
    tmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalg
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >5y5sZ (Z:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5sZ (Z:)
    tgltddeakefhaifmqsmyawfglvviahllawlyrpwl