PDB entry 5y5n

View 5y5n on RCSB PDB site
Description: Crystal structure of human Sirtuin 2 in complex with a selective inhibitor
Class: hydrolase/inhibitor
Keywords: Pseudopeptides, Anticancer activity, Neurite outgrowth, HYDROLASE-INHIBITOR complex
Deposited on 2017-08-09, released 2017-09-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nad-dependent protein deacetylase sirtuin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: SIRT2, SIR2L, SIR2L2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IXJ6 (2-335)
      • see sequence details (256)
      • see sequence details (256)
      • see sequence details (256)
      • see sequence details (256)
      • see sequence details (256)
      • see sequence details (256)
    Domains in SCOPe 2.06: d5y5na_
  • Heterogens: ZN, 8NO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y5nA (A:)
    gsgeadmdflrnlfsqtlslgsqkerlldeltlegvarymqsercrrviclvgagistsa
    gipdfrspstglydnlekyhlpypeaifeisyfkkhpepffalakelypgqfkptichyf
    mrllkdkglllrcytqnidtleriagleqedlveahgtfytshcvsascrheyplswmke
    kifsevtpkcedcqslvkpdivffgeslparffscmqsdflkvdlllvmgtslqvqpfas
    liskaplstprllinkekagqsdpflgmimglgggmdlgetpfddiatfdskkayrdvaw
    lgecdqgclalaellgwkkeledlvrrehasidaqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5nA (A:)
    geadmdflrnlfsqtlslgsqkerlldeltlegvarymqsercrrviclvgagistsagi
    pdfrsphlpypeaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrc
    ytqnidtleriagleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedc
    qslvkpdivffgeslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprll
    inkekayrdvawlgecdqgclalaellgwkkeledlvrrehasidaqs