PDB entry 5y5m

View 5y5m on RCSB PDB site
Description: SFX structure of cytochrome P450nor: a complete dark data without pump laser (resting state)
Class: oxidoreductase
Keywords: metal-binding, OXIDOREDUCTASE
Deposited on 2017-08-09, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADP nitrous oxide-forming nitric oxide reductase
    Species: Fusarium oxysporum [TaxId:5507]
    Gene: CYP55A1, CYP55
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5ma_
  • Chain 'B':
    Compound: NADP nitrous oxide-forming nitric oxide reductase
    Species: Fusarium oxysporum [TaxId:5507]
    Gene: CYP55A1, CYP55
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5mb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y5mA (A:)
    masgapsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatsekl
    skvrtrqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrt
    vddlleqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsst
    areasaanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvag
    natmvnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmi
    gdklvranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlaka
    elttvfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5mA (A:)
    apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr
    trqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl
    leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarea
    saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnatm
    vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmigdkl
    vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt
    vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5y5mB (B:)
    masgapsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatsekl
    skvrtrqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrt
    vddlleqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsst
    areasaanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvag
    natmvnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmi
    gdklvranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlaka
    elttvfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5mB (B:)
    apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr
    trqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl
    leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarea
    saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnatm
    vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmigdkl
    vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt
    vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif