PDB entry 5y5e

View 5y5e on RCSB PDB site
Description: Crystal structure of phospholipase A2 with inhibitor
Class: hydrolase/inhibitor
Keywords: mutant, HYDROLASE-INHIBITOR complex
Deposited on 2017-08-08, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Group IIE secretory phospholipase A2
    Species: Homo sapiens [TaxId:9606]
    Gene: PLA2G2E
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZK7 (Start-122)
      • engineered mutation (20)
    Domains in SCOPe 2.07: d5y5ea_
  • Heterogens: GOL, 7W3, CL, CA, B3P, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y5eA (A:)
    nlvqfgvmiekmtgksalqygdygcycgiggshwpvdqtdwcchahdccygrleklgcep
    klekylfsvsergifcagrttcqrltcecdkraalcfrrnlgtynrkyahypnklctgpt
    ppc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5eA (A:)
    vqfgvmiekmtgksalqygdygcycgiggshwpvdqtdwcchahdccygrleklgcepkl
    ekylfsvsergifcagrttcqrltcecdkraalcfrrnlgtynrkyahypnklctgptpp
    c