PDB entry 5y5c

View 5y5c on RCSB PDB site
Description: Crystal structure of dha bind to bovine beta-lactoglobulin
Class: lipid binding protein
Keywords: Lactoglobulin Fatty acid Crystal structure, LIPID BINDING PROTEIN
Deposited on 2017-08-08, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactoglobulin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5ca_
  • Chain 'B':
    Compound: beta-lactoglobulin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5cb_
  • Heterogens: HXA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y5cA (A:)
    livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
    clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5cA (A:)
    tqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkwen
    gecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqclv
    rtpevddealekfdkalkalpmhirlsfnptqleeqchi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5y5cB (B:)
    livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
    clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5cB (B:)
    qtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkweng
    ecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqclvr
    tpevddealekfdkalkalpmhirlsfnptqleeqchi