PDB entry 5y5b

View 5y5b on RCSB PDB site
Description: Crystal Structure Of IMP-1 Metallo-beta-lactamase
Class: hydrolase
Keywords: hydrolase
Deposited on 2017-08-08, released 2018-08-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: XRAY
Resolution: 1.7000000000000002 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallo-beta-lactamase type 2
    Species: Serratia marcescens [TaxId:615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5y5ba_
  • Heterogens: ZN, SO4, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y5bA (A:)
    aeslpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklv
    twfvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsg
    vnywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksa
    kllkskygkaklvvpshsevgdasllkltleqavkglneskkpskpsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5bA (A:)
    slpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtw
    fvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvn
    ywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakl
    lkskygkaklvvpshsevgdasllkltleqavkglneskkp