PDB entry 5y52

View 5y52 on RCSB PDB site
Description: Crystal Structure of Highly Active BTUO Mutant P287G Improved by Humidity Control at 83% RH
Class: oxidoreductase
Keywords: Protein engineering, Oxidase, pH dependence, enzyme activation, flexibility, loop plasticity, OXIDOREDUCTASE
Deposited on 2017-08-07, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uric acid degradation bifunctional protein
    Species: Bacillus sp. (strain TB-90) [TaxId:36824]
    Gene: uao
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y52a1, d5y52a2
  • Chain 'B':
    Compound: Uric acid degradation bifunctional protein
    Species: Bacillus sp. (strain TB-90) [TaxId:36824]
    Gene: uao
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y52b1, d5y52b2
  • Chain 'C':
    Compound: Uric acid degradation bifunctional protein
    Species: Bacillus sp. (strain TB-90) [TaxId:36824]
    Gene: uao
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y52c1, d5y52c2
  • Chain 'D':
    Compound: Uric acid degradation bifunctional protein
    Species: Bacillus sp. (strain TB-90) [TaxId:36824]
    Gene: uao
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y52d1, d5y52d2
  • Heterogens: AZA, OXY, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y52A (A:)
    tkhkervmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtkllts
    ftkgdnslvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeip
    fettfavkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsg
    nsfvgfirdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvf
    hetetlsiqhliyligrrilerfpqlqevyfesqnhtwdkiveeigesegkvyteprppy
    gfqcftvtqedlphenilmfsdepdhkgalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y52A (A:)
    vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
    slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
    vkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvgf
    irdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetetl
    siqhliyligrrilerfpqlqevyfesqnhtwdkigkvyteprppygfqcftvtq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5y52B (B:)
    tkhkervmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtkllts
    ftkgdnslvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeip
    fettfavkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsg
    nsfvgfirdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvf
    hetetlsiqhliyligrrilerfpqlqevyfesqnhtwdkiveeigesegkvyteprppy
    gfqcftvtqedlphenilmfsdepdhkgalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y52B (B:)
    vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
    slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
    vkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvgf
    irdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetetl
    siqhliyligrrilerfpqlqevyfesqnhtwdkiegkvyteprppygfqcftvtq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5y52C (C:)
    tkhkervmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtkllts
    ftkgdnslvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeip
    fettfavkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsg
    nsfvgfirdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvf
    hetetlsiqhliyligrrilerfpqlqevyfesqnhtwdkiveeigesegkvyteprppy
    gfqcftvtqedlphenilmfsdepdhkgalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y52C (C:)
    vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
    slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
    vkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvgf
    irdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetetl
    siqhliyligrrilerfpqlqevyfesqnhtwdkiegkvyteprppygfqcftvtq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5y52D (D:)
    tkhkervmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtkllts
    ftkgdnslvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeip
    fettfavkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsg
    nsfvgfirdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvf
    hetetlsiqhliyligrrilerfpqlqevyfesqnhtwdkiveeigesegkvyteprppy
    gfqcftvtqedlphenilmfsdepdhkgalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y52D (D:)
    vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
    slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
    vkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvgf
    irdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetetl
    siqhliyligrrilerfpqlqevyfesqnhtwdkigkvyteprppygfqcftvtq