PDB entry 5y4t

View 5y4t on RCSB PDB site
Description: Crystal structure of Trx domain of Grx3 from Saccharomyces cerevisiae
Class: oxidoreductase
Keywords: Oxidoreductase, glutaredoxins reduction
Deposited on 2017-08-05, released 2018-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutaredoxin
    Species: Saccharomyces cerevisiae [TaxId:307796]
    Gene: GRX3, SCY_1000
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6ZY62 (Start-113)
      • expression tag (114-117)
    Domains in SCOPe 2.07: d5y4ta1, d5y4ta2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y4tA (A:)
    mpvieindqeqftyltttaagdklivlyfhtswaepckalkqvfeaisnepsnsnvsfls
    idadenseiselfeisavpyfiiihkgtilkelsgadpkefvslledcknsvnslehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y4tA (A:)
    pvieindqeqftyltttaagdklivlyfhtswaepckalkqvfeaisnepsnsnvsflsi
    dadenseiselfeisavpyfiiihkgtilkelsgadpkefvslledcknsvnslehh