PDB entry 5y4r

View 5y4r on RCSB PDB site
Description: Structure of a methyltransferase complex
Class: transferase/protein binding
Keywords: Complex, TRANSFERASE-PROTEIN BINDING complex
Deposited on 2017-08-04, released 2017-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemotaxis protein methyltransferase 1
    Species: Pseudomonas aeruginosa str. PAO1 [TaxId:208964]
    Gene: cheR1, PA3348
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Chemotaxis protein methyltransferase 1
    Species: Pseudomonas aeruginosa str. PAO1 [TaxId:208964]
    Gene: cheR1, PA3348
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Cyclic diguanosine monophosphate-binding protein PA4608
    Species: Pseudomonas aeruginosa str. PAO1 [TaxId:208964]
    Gene: PA4608
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y4rc_
  • Chain 'D':
    Compound: Cyclic diguanosine monophosphate-binding protein PA4608
    Species: Pseudomonas aeruginosa str. PAO1 [TaxId:208964]
    Gene: PA4608
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y4rd_
  • Heterogens: SO4, C2E, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5y4rC (C:)
    mgsshhhhhhsqdpenlyfqgsdqhderrrfhriafdadseilqgerrwevllhdvslhg
    ilvgqpqdwngdpqrpfearlylgldvlirmeislawardgllgfecqhidldsishlrr
    lvelnlgdeellerelallvsahdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y4rC (C:)
    derrrfhriafdadseilqgerrwevllhdvslhgilvgqpqdwngdpqrpfearlylgl
    dvlirmeislawardgllgfecqhidldsishlrrlvelnlgdeellerelallvsah
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5y4rD (D:)
    mgsshhhhhhsqdpenlyfqgsdqhderrrfhriafdadseilqgerrwevllhdvslhg
    ilvgqpqdwngdpqrpfearlylgldvlirmeislawardgllgfecqhidldsishlrr
    lvelnlgdeellerelallvsahdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y4rD (D:)
    derrrfhriafdadseilqgerrwevllhdvslhgilvgqpqdwngdpqrpfearlylgl
    dvlirmeislawardgllgfecqhidldsishlrrlvelnlgdeellerelallvsahd