PDB entry 5y4q

View 5y4q on RCSB PDB site
Description: Crystal structure of Trypanosoma cruzi spermidine synthase in complex with N-(4-methoxyphenyl)quinolin-4-amine
Class: transferase
Keywords: polyamine synthesis, TRANSFERASE
Deposited on 2017-08-04, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spermidine synthase, putative
    Species: Trypanosoma cruzi (strain CL Brener) [TaxId:353153]
    Gene: Tc00.1047053510339.50
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y4qa_
  • Chain 'B':
    Compound: Spermidine synthase, putative
    Species: Trypanosoma cruzi (strain CL Brener) [TaxId:353153]
    Gene: Tc00.1047053510339.50
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y4qb_
  • Chain 'C':
    Compound: Spermidine synthase, putative
    Species: Trypanosoma cruzi (strain CL Brener) [TaxId:353153]
    Gene: Tc00.1047053510339.50
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y4qc_
  • Chain 'D':
    Compound: Spermidine synthase, putative
    Species: Trypanosoma cruzi (strain CL Brener) [TaxId:353153]
    Gene: Tc00.1047053510339.50
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y4qd_
  • Heterogens: S4M, 8OF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y4qA (A:)
    mahhhhhhmpgselisggwfreendqwpgqamslrvekvlydaptkfqhltifesdpkgp
    wgtvmaldgciqvtdydefvyhevlghtslcshpkpervliigggdggvlrevlrhgtve
    hcdlvdidgevmeqskqhfpqisrsladpratvrvgdglafvrqtpdntydvviidttdp
    agpasklfgeafykdvlrilkpdgiccnqgesiwldleliekmsrfiretgfasvqyalm
    hvptypcgsigtlvcskkagvdvtkplrpvedmpfakdlkyydsemhkasfalprfarhi
    nnse
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y4qA (A:)
    gwfreendqwpgqamslrvekvlydaptkfqhltifesdpkgpwgtvmaldgciqvtdyd
    efvyhevlghtslcshpkpervliigggdggvlrevlrhgtvehcdlvdidgevmeqskq
    hfpqisrsladpratvrvgdglafvrqtpdntydvviidttafykdvlrilkpdgiccnq
    gesiwldleliekmsrfiretgfasvqyalmhvptypcgsigtlvcskkagvdvtkplrp
    vedmpfakdlkyydsemhkasfalprfarhinn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5y4qB (B:)
    mahhhhhhmpgselisggwfreendqwpgqamslrvekvlydaptkfqhltifesdpkgp
    wgtvmaldgciqvtdydefvyhevlghtslcshpkpervliigggdggvlrevlrhgtve
    hcdlvdidgevmeqskqhfpqisrsladpratvrvgdglafvrqtpdntydvviidttdp
    agpasklfgeafykdvlrilkpdgiccnqgesiwldleliekmsrfiretgfasvqyalm
    hvptypcgsigtlvcskkagvdvtkplrpvedmpfakdlkyydsemhkasfalprfarhi
    nnse
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y4qB (B:)
    elisggwfreendqwpgqamslrvekvlydaptkfqhltifesdpkgpwgtvmaldgciq
    vtdydefvyhevlghtslcshpkpervliigggdggvlrevlrhgtvehcdlvdidgevm
    eqskqhfpqisrsladpratvrvgdglafvrqtpdntydvviidttasklafykdvlril
    kpdgiccnqgesiwldleliekmsrfiretgfasvqyalmhvptysigtlvcskkagvdv
    tkplrpvedmpfakdlkyydsemhkasfalprfarhinn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5y4qC (C:)
    mahhhhhhmpgselisggwfreendqwpgqamslrvekvlydaptkfqhltifesdpkgp
    wgtvmaldgciqvtdydefvyhevlghtslcshpkpervliigggdggvlrevlrhgtve
    hcdlvdidgevmeqskqhfpqisrsladpratvrvgdglafvrqtpdntydvviidttdp
    agpasklfgeafykdvlrilkpdgiccnqgesiwldleliekmsrfiretgfasvqyalm
    hvptypcgsigtlvcskkagvdvtkplrpvedmpfakdlkyydsemhkasfalprfarhi
    nnse
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y4qC (C:)
    gwfreendqpgqamslrvekvlydaptkfqhltifesdpkgpwgtvmaldgciqvtdyde
    fvyhevlghtslcshpkpervliigggdggvlrevlrhgtvehcdlvdidgevmeqskqh
    fpqisrsladpratvrvgdglafvrqtpdntydvviidttafykdvlrilkpdgiccnqg
    esiwldleliekmsrfiretgfasvqyalmhvptypcgsigtlvcskkagvdvtkplrpv
    edmpfakdlkyydsemhkasfalprfarhinn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5y4qD (D:)
    mahhhhhhmpgselisggwfreendqwpgqamslrvekvlydaptkfqhltifesdpkgp
    wgtvmaldgciqvtdydefvyhevlghtslcshpkpervliigggdggvlrevlrhgtve
    hcdlvdidgevmeqskqhfpqisrsladpratvrvgdglafvrqtpdntydvviidttdp
    agpasklfgeafykdvlrilkpdgiccnqgesiwldleliekmsrfiretgfasvqyalm
    hvptypcgsigtlvcskkagvdvtkplrpvedmpfakdlkyydsemhkasfalprfarhi
    nnse
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y4qD (D:)
    elisggwfreendpgqamslrvekvlydaptkfqhltifesdpkgpwgtvmaldgciqvt
    dydefvyhevlghtslcshpkpervliigggdggvlrevlrhgtvehcdlvdidgevmeq
    skqhfpqisrsladpratvrvgdglafvrqtpdntydvviidtfykdvlrilkpdgiccn
    qgesiwldleliekmsrfiretgfasvqyalmhvptyigtlvcskkagvdvtkplrpved
    mpfakdlkyydsemhkasfalprfarhinn