PDB entry 5y4a

View 5y4a on RCSB PDB site
Description: Cadmium directed assembly of adenine phosphoribosyltransferase from Yersinia pseudotuberculosis.
Class: transferase
Keywords: Transferase
Deposited on 2017-08-02, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenine phosphoribosyltransferase
    Species: Yersinia pseudotuberculosis serotype I (strain IP32953) [TaxId:273123]
    Gene: apt, YPTB0991
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y4aa_
  • Chain 'B':
    Compound: Adenine phosphoribosyltransferase
    Species: Yersinia pseudotuberculosis serotype I (strain IP32953) [TaxId:273123]
    Gene: apt, YPTB0991
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y4ab_
  • Heterogens: NA, SO4, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y4aA (A:)
    mtvsasktaqqlkyikdsiktipdypkagilfrdvtsllenpkaysasiellsehysesg
    vtkvvgteargflfgapvalalgvgfvpvrkpgklpretisesyeleygtdtleihtdsi
    qpgdkvlvvddllatggtieatvklirrlggevvhaafiinlpelggearltqqgihcys
    lvsfdgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y4aA (A:)
    ktaqqlkyikdsiktipdypkagilfrdvtsllenpkaysasiellsehysesgvtkvvg
    teargflfgapvalalgvgfvpvrkpgklpretisesyeleygtdtleihtdsiqpgdkv
    lvvddllatggtieatvklirrlggevvhaafiinlpelggearltqqgihcyslvsfdg
    h
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5y4aB (B:)
    mtvsasktaqqlkyikdsiktipdypkagilfrdvtsllenpkaysasiellsehysesg
    vtkvvgteargflfgapvalalgvgfvpvrkpgklpretisesyeleygtdtleihtdsi
    qpgdkvlvvddllatggtieatvklirrlggevvhaafiinlpelggearltqqgihcys
    lvsfdgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y4aB (B:)
    vsasktaqqlkyikdsiktipdypilfrdvtsllenpkaysasiellsehysesgvtkvv
    gteargflfgapvalalgvgfvpvrkpgklpretisesyeltdtleihtdsiqpgdkvlv
    vddllatggtieatvklirrlggevvhaafiinlpelggearltqqgihcyslvsfdg