PDB entry 5y42

View 5y42 on RCSB PDB site
Description: Native-crystal structure of three chain non-toxic type II ribosome inactivating protein purified from the seeds of Trichosanthes anguina
Class: plant protein
Keywords: beta-trefoil, Lectin, PLANT PROTEIN
Deposited on 2017-07-31, released 2018-08-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Trichosanthes anguina [TaxId:50544]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: seed lectin
    Species: Trichosanthes anguina [TaxId:50544]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: seed lectin
    Species: Trichosanthes anguina [TaxId:50544]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5y42c1, d5y42c2
  • Chain 'D':
    Compound: lectin
    Species: Trichosanthes anguina [TaxId:50544]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: seed lectin
    Species: Trichosanthes anguina [TaxId:50544]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: seed lectin
    Species: Trichosanthes anguina [TaxId:50544]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5y42f1, d5y42f2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5y42C (C:)
    neclvetrttrisgrdalcvdvagaltsdgsrlilypcgqqvnqkwtfhsdgtvrslgkc
    latnnskfgnlvviydcsklaaediswdvsvggtimnpnyedlaltsnkatrstnltmev
    ntysasqgwrvgnyvqpiigsivglddmcleatdgntnmwleecvpnqreqswalysdgt
    irvddnrelcvtassstydnwkvitilncdgsnnqrwvfladgsistpgnqrlamdvars
    dvdlkkiilhrphgdlnqqwvlfy
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5y42F (F:)
    neclvetrttrisgrdalcvdvagaltsdgsrlilypcgqqvnqkwtfhsdgtvrslgkc
    latnnskfgnlvviydcsklaaediswdvsvggtimnpnyedlaltsnkatrstnltmev
    ntysasqgwrvgnyvqpiigsivglddmcleatdgntnmwleecvpnqreqswalysdgt
    irvddnrelcvtassstydnwkvitilncdgsnnqrwvfladgsistpgnqrlamdvars
    dvdlkkiilhrphgdlnqqwvlfy