PDB entry 5y41

View 5y41 on RCSB PDB site
Description: Crystal Structure of LIGAND-BOUND NURR1-LBD
Class: transcription
Keywords: Nurr1, LBD, Prostaglandin, TRANSCRIPTION, MICHAEL ADDITION
Deposited on 2017-07-31, released 2018-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor subfamily 4 group A member 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NR4A2, NOT, NURR1, TINUR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y41a_
  • Chain 'B':
    Compound: Nuclear receptor subfamily 4 group A member 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NR4A2, NOT, NURR1, TINUR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y41b_
  • Heterogens: RPG, PGE, PEG, CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y41A (A:)
    mvkevvrtdslkgrrgrlpskpkspqepsppsppvslisalvrahvdsnpamtsldysrf
    qanpdyqmsgddtqhiqqfydlltgsmeiirgwaekipgfadlpkadqdllfesaflelf
    vlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsivefssnlqnmnidisafscia
    alamvterhglkepkrveelqnkivnclkdhvtfnngglnrpnylskllgklpelrtlct
    qglqrifylkledlvpppaiidklfldtlpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y41A (A:)
    vslisalvrahvdsnpamtsldysrfqanpdddtqhiqqfydlltgsmeiirgwaekipg
    fadlpkadqdllfesaflelfvlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsi
    vefssnlqnmnidisafsciaalamvterhglkepkrveelqnkivnclkdhvtfnnggl
    nrpnylskllgklpelrtlctqglqrifylkledlvpppaiidklfldtlpf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5y41B (B:)
    mvkevvrtdslkgrrgrlpskpkspqepsppsppvslisalvrahvdsnpamtsldysrf
    qanpdyqmsgddtqhiqqfydlltgsmeiirgwaekipgfadlpkadqdllfesaflelf
    vlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsivefssnlqnmnidisafscia
    alamvterhglkepkrveelqnkivnclkdhvtfnngglnrpnylskllgklpelrtlct
    qglqrifylkledlvpppaiidklfldtlpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y41B (B:)
    ppvslisalvrahvdsnpamtsldysrfqanpdtqhiqqfydlltgsmeiirgwaekipg
    fadlpkadqdllfesaflelfvlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsi
    vefssnlqnmnidisafsciaalamvterhglkepkrveelqnkivnclkdhvtfnnggl
    nrpnylskllgklpelrtlctqglqrifylkledlvpppaiidklfldtlpf