PDB entry 5y3c

View 5y3c on RCSB PDB site
Description: Crystal structure of zebrafish Ccd1 DIX domain
Class: signaling protein
Keywords: Wnt signal, SIGNALING PROTEIN
Deposited on 2017-07-28, released 2017-09-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dixin-A
    Species: Danio rerio [TaxId:7955]
    Gene: dixdc1a, ccd1, dixdc1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q804T6 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d5y3ca1, d5y3ca2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5y3cA (A:)
gpaaastkvlyytdrsltpflvnipkrlgdvtlqdfkaavdrhgsfryhfksldpefgtv
keevfqddavipgwegkivawveed

    Sequence, based on observed residues (ATOM records): (download) 
    >5y3cA (A:)
paaastkvlyytdrsltpflvnipkrlgdvtlqdfkaavdrhgsfryhfksldpefgtvk
eevfqddavipgwegkivawvee