PDB entry 5y39

View 5y39 on RCSB PDB site
Description: Crystal structure of Ragulator complex (p18 76-145)
Class: signaling protein
Keywords: Ragulator complex, LAMTOR, SIGNALING PROTEIN
Deposited on 2017-07-28, released 2017-12-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ragulator complex protein LAMTOR1
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR1, C11orf59, PDRO, PP7157
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ragulator complex protein LAMTOR2
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR2, MAPBPIP, ROBLD3, HSPC003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5y39b_
  • Chain 'C':
    Compound: Ragulator complex protein LAMTOR3
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR3, MAP2K1IP1, MAPKSP1, PRO2783
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5y39c_
  • Chain 'D':
    Compound: Ragulator complex protein LAMTOR4
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR4, C7orf59
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0VGL1 (2-End)
      • expression tag (1)
  • Chain 'E':
    Compound: Ragulator complex protein LAMTOR5
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR5, HBXIP, XIP
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Ragulator complex protein LAMTOR1
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR1, C11orf59, PDRO, PP7157
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Ragulator complex protein LAMTOR2
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR2, MAPBPIP, ROBLD3, HSPC003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5y39g_
  • Chain 'H':
    Compound: Ragulator complex protein LAMTOR3
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR3, MAP2K1IP1, MAPKSP1, PRO2783
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5y39h_
  • Chain 'I':
    Compound: Ragulator complex protein LAMTOR4
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR4, C7orf59
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Ragulator complex protein LAMTOR5
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR5, HBXIP, XIP
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5y39B (B:)
    mlrpkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrng
    nqafnednlkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleeplt
    qvaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y39B (B:)
    kaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrngnqaf
    nednlkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleeplt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5y39C (C:)
    maddlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalatdqg
    sklglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelrqv
    vevs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y39C (C:)
    ddlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalatdqgsk
    lglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelrqvve
    v
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5y39G (G:)
    mlrpkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrng
    nqafnednlkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleeplt
    qvaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y39G (G:)
    altqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrngnqafn
    ednlkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleepltqv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5y39H (H:)
    maddlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalatdqg
    sklglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelrqv
    vevs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y39H (H:)
    ddlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalatdqgsk
    lglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelrq
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.