PDB entry 5y30

View 5y30 on RCSB PDB site
Description: Crystal structure of LGI1 LRR domain
Class: cell adhesion
Keywords: epilepsy, synapse, ADAM, EPTP, WD40, CELL ADHESION
Deposited on 2017-07-27, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leucine-rich glioma-inactivated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: LGI1, EPT, UNQ775/PRO1569
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y30a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y30A (A:)
    daaqparrarrtyeaypakpkcpavctctkdnalcenarsiprtvppdvislsfvrsgft
    eisegsflftpslqlllftsnsfdvisddafiglphleylfiennniksisrhtfrglks
    lihlslannnlqtlpkdifkgldsltnvdlrgnsfncdcklkwlvewlghtnatvediyc
    egppeykkrkinslsskdfdciikhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y30A (A:)
    kcpavctctkdnalcenarsiprtvppdvislsfvrsgfteisegsflftpslqlllfts
    nsfdvisddafiglphleylfiennniksisrhtfrglkslihlslannnlqtlpkdifk
    gldsltnvdlrgnsfncdcklkwlvewlghtnatvediycegppeykkrkinslsskdfd
    ci