PDB entry 5y2t

View 5y2t on RCSB PDB site
Description: Structure of PPARgamma ligand binding domain - lobeglitazone complex
Class: transcription
Keywords: PPARgamma, nuclear receptor, pioglitazone, thiazolidinedione, ligand binding domain, TRANSCRIPTION
Deposited on 2017-07-27, released 2017-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y2ta_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37231 (23-End)
      • expression tag (18-22)
    Domains in SCOPe 2.07: d5y2tb1, d5y2tb2
  • Heterogens: 8LX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y2tA (A:)
    mgsshhhhhhssglvprgsamgsesadlralakhlydsyiksfpltkakarailtgkttd
    kspfviydmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksi
    pgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdf
    mepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlkl
    nhpessqlfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y2tA (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikqsk
    evairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmn
    kdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsg
    drpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqv
    ikktetdmslhpllqeiykdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5y2tB (B:)
    mgsshhhhhhssglvprgsamgsesadlralakhlydsyiksfpltkakarailtgkttd
    kspfviydmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksi
    pgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdf
    mepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlkl
    nhpessqlfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y2tB (B:)
    samgsesadlralakhlydsyiksfpltkakarailtgspfviydmnslmmgedkikfkh
    itkevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlas
    lmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiavii
    lsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvql
    lqvikktetdmslhpllqeiykd