PDB entry 5y2o

View 5y2o on RCSB PDB site
Description: Structure of PPARgamma ligand binding domain-pioglitazone complex
Class: transcription
Keywords: PPARgamma, nuclear receptor, pioglitazone, thiazolidinedione, ligand binding domain, TRANSCRIPTION
Deposited on 2017-07-26, released 2017-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y2oa_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37231 (23-End)
      • expression tag (19-22)
    Domains in SCOPe 2.07: d5y2ob1, d5y2ob2
  • Heterogens: 8N6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y2oA (A:)
    mgsshhhhhhssglvprgsamgsesadlralakhlydsyiksfpltkakarailtgkttd
    kspfviydmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksi
    pgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdf
    mepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlkl
    nhpessqlfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y2oA (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikqsk
    evairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmn
    kdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsg
    drpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqv
    ikktetdmslhpllqeiykdly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5y2oB (B:)
    mgsshhhhhhssglvprgsamgsesadlralakhlydsyiksfpltkakarailtgkttd
    kspfviydmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksi
    pgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdf
    mepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlkl
    nhpessqlfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y2oB (B:)
    amgsesadlralakhlydsyiksfpltkakarailtgspfviydmnslmmgedkikfkhi
    tkevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlasl
    mnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviil
    sgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqll
    qvikktethpllqeiyk