PDB entry 5y2l

View 5y2l on RCSB PDB site
Description: Crystal structure of a group 2 HA binding antibody AF4H1K1 Fab in complex with the 1968 H3N2 pandemic (H3-AC/68) hemagglutinin
Class: antimicrobial protein
Keywords: neutralizing antibody, influenza virus, HA, H3-clade, ANTIMICROBIAL PROTEIN
Deposited on 2017-07-26, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (strain A/Aichi/2/1968 H3N2) [TaxId:387139]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y2la_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (strain A/Aichi/2/1968 H3N2) [TaxId:387139]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y2lb_
  • Chain 'I':
    Compound: a group 2 HA binding antibody AF4H1K1 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5Y2L (0-End)
  • Chain 'J':
    Compound: a group 2 HA binding antibody AF4H1K1 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5Y2L (0-End)
    Domains in SCOPe 2.07: d5y2lj1, d5y2lj2
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y2lA (A:)
    qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
    gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
    itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
    gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y2lA (A:)
    statlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
    allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
    gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgihhpstn
    qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5y2lB (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y2lB (B:)
    iengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektnekfhqieke
    fsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfektrrqlren
    aeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5y2lJ (J:)
    divmtqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliyrassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygssftfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgechhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y2lJ (J:)
    divmtqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliyrassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygssftfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrg