PDB entry 5y25

View 5y25 on RCSB PDB site
Description: EGFR kinase domain mutant (T790M/L858R) with covalent ligand NS-062
Class: transferase/transferase inhibitor
Keywords: Inhibitor, complex, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2017-07-24, released 2018-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (7-End)
      • expression tag (6)
      • engineered mutation (99)
      • engineered mutation (167)
    Domains in SCOPe 2.07: d5y25a1, d5y25a2
  • Heterogens: 8LU

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y25A (A:)
    mhhhhhhapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelrea
    tspkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnig
    sqyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgrakllgaeekeyh
    aeggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekg
    erlpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlp
    sptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y25A (A:)
    hapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikeltspkankei
    ldeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcv
    qiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgravpikwmalesilhriythqs
    dvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmida
    dsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfddvvdadeyl