PDB entry 5y0z

View 5y0z on RCSB PDB site
Description: Human SIRT2 in complex with a specific inhibitor, NPD11033
Class: hydrolase/inhibitor
Keywords: sirtuin, SIRT, NAD-dependent deacetylase, HYDROLASE-INHIBITOR complex
Deposited on 2017-07-19, released 2018-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nad-dependent protein deacetylase sirtuin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: SIRT2, SIR2L, SIR2L2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y0za_
  • Chain 'B':
    Compound: nad-dependent protein deacetylase sirtuin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: SIRT2, SIR2L, SIR2L2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y0zb_
  • Heterogens: ZN, 8K9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y0zA (A:)
    gsqkerlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnlekyh
    lpypeaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidt
    leriagleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpd
    ivffgeslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekag
    gggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasidaqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y0zA (A:)
    erlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnlekyhlpyp
    eaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtleri
    agleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdivff
    geslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagggmd
    fdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasidaqs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5y0zB (B:)
    gsqkerlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnlekyh
    lpypeaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidt
    leriagleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpd
    ivffgeslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekag
    gggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasidaqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y0zB (B:)
    kerlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnlekyhlpy
    peaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtler
    iagleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdivf
    fgeslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagggm
    dfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasidaqs