PDB entry 5y0g

View 5y0g on RCSB PDB site
Description: Crystal structure of human FABP4 complexed with ligand 4-Fluoro-3-((4-methoxynaphthalene)-1-sulfonamido) benzoic acid
Class: lipid binding protein
Keywords: lipid binding protein, FABP4, inhibitor
Deposited on 2017-07-17, released 2018-06-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty acid-binding protein, adipocyte
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15090 (20-151)
      • expression tag (16-19)
    Domains in SCOPe 2.08: d5y0ga1, d5y0ga2
  • Heterogens: 8JL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5y0gA (A:)
mgsshhhhhhssglvprgshmcdafvgtwklvssenfddymkevgvgfatrkvagmakpn
miisvngdvitiksestfknteisfilgqefdevtaddrkvkstitldggvlvhvqkwdg
ksttikrkreddklvvecvmkgvtstrvyera

    Sequence, based on observed residues (ATOM records): (download) 
    >5y0gA (A:)
rgshmcdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdvitikses
tfknteisfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttikrkreddklvv
ecvmkgvtstrvyera