PDB entry 5y07

View 5y07 on RCSB PDB site
Description: Crystal structure of adenine phosphoribosyltransferase from Yersinia pseudotuberculosis with PRPP.
Class: transferase
Keywords: transferase
Deposited on 2017-07-25, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenine phosphoribosyltransferase
    Species: Yersinia pseudotuberculosis IP 32953 [TaxId:273123]
    Gene: apt, YPTB0991
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y07a_
  • Chain 'B':
    Compound: Adenine phosphoribosyltransferase
    Species: Yersinia pseudotuberculosis IP 32953 [TaxId:273123]
    Gene: apt, YPTB0991
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y07b_
  • Heterogens: PRP, NA, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y07A (A:)
    mtvsasktaqqlkyikdsiktipdypkagilfrdvtsllenpkaysasiellsehysesg
    vtkvvgteargflfgapvalalgvgfvpvrkpgklpretisesyeleygtdtleihtdsi
    qpgdkvlvvddllatggtieatvklirrlggevvhaafiinlpelggearltqqgihcys
    lvsfdgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y07A (A:)
    taqqlkyikdsiktipdypkagilfrdvtsllenpkaysasiellsehysesgvtkvvgt
    eargflfgapvalalgvgfvpvrkpgklpretisesyeleygtdtleihtdsiqpgdkvl
    vvddllatggtieatvklirrlggevvhaafiinlpelggearltqqgihcyslvsfdg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5y07B (B:)
    mtvsasktaqqlkyikdsiktipdypkagilfrdvtsllenpkaysasiellsehysesg
    vtkvvgteargflfgapvalalgvgfvpvrkpgklpretisesyeleygtdtleihtdsi
    qpgdkvlvvddllatggtieatvklirrlggevvhaafiinlpelggearltqqgihcys
    lvsfdgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y07B (B:)
    taqqlkyikdsiktipdypkagilfrdvtsllenpkaysasiellsehysesgvtkvvgt
    eargflfgapvalalgvgfvpvrkpgklpretisesyeleygtdtleihtdsiqpgdkvl
    vvddllatggtieatvklirrlggevvhaafiinlpelggearltqqgihcyslvsfd