PDB entry 5y04

View 5y04 on RCSB PDB site
Description: Crystal Structure of the complex between the vinculin D1 domain and alphaE-catenin
Class: cell adhesion
Keywords: adherens junction, cytoskeleton, cell adhesion
Deposited on 2017-07-14, released 2018-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vinculin
    Species: Mus musculus [TaxId:10090]
    Gene: VCL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y04a1, d5y04a2
  • Chain 'B':
    Compound: Catenin alpha-1
    Species: Mus musculus [TaxId:10090]
    Gene: Ctnna1, Catna1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y04A (A:)
    gpmpvfhtrtiesilepvaqqishlvimheegevdgkaipdltapvaavqaavsnlvrvg
    ketvqttedqilkrdmppafikvenactklvqaaqmlqsdpysvpardylidgsrgilsg
    tsdllltfdeaevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmider
    qqelthqehrvmlvnsmntvkellpvlisamkifvttknsknqgieealknrnftvekms
    aeineiirvlql
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y04A (A:)
    mpvfhtrtiesilepvaqqishlvimheegevdgkaipdltapvaavqaavsnlvrvgke
    tvqttedqilkrdmppafikvenactklvqaaqmlqsdpysvpardylidgsrgilsgts
    dllltfdeaevrkiirvckgileyltvaevvtmedvtytknlgpgmtkmakmiderqqel
    thqehrvmlvnsmntvkellpvlisamkifvieealknrnftvekmsaeineiirvlql
    

  • Chain 'B':
    No sequence available.