PDB entry 5y03

View 5y03 on RCSB PDB site
Description: Galectin-13/Placental Protein 13 variant R53H crystal structure
Class: sugar binding protein
Keywords: Galectin-13/Placental Protein 13, SUGAR BINDING PROTEIN
Deposited on 2017-07-14, released 2018-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galactoside-binding soluble lectin 13
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS13, PLAC8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UHV8 (Start-141)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d5y03a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y03A (A:)
    gshmsslpvpyklpvslsvgscviikgtpihsfindpqlqvdfytdmdedsdiafhfrvh
    fgnhvvmnrrefgiwmleettdyvpfedgkqfelciyvhyneyeikvngiriygfvhrip
    psfvkmvqvsrdisltsvcvcn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y03A (A:)
    sslpvpyklpvslsvgscviikgtpihsfindpqlqvdfytdmdedsdiafhfrvhfgnh
    vvmnrrefgiwmleettdyvpfedgkqfelciyvhyneyeikvngiriygfvhrippsfv
    kmvqvsrdisltsvcvcn