SCOPe 2.08: Structural Classification of Proteins

PDB entry 5y02

View 5y02 on RCSB PDB site
Description: C-terminal peptide depleted mutant of hydroxynitrile lyase from Passiflora edulis (PeHNL) bound with (R)-mandelonitrile
Class: lyase
Keywords: Hydroxynitrile lyase, Cyanohydrins, LYASE
Deposited on 2017-07-14, released 2017-11-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: hydroxynitrile lyase
Species: Passiflora edulis [TaxId:78168]
Gene: PeHNL
Database cross-references and differences (RAF-indexed):
- Uniprot A0A1L7NZN4 (Start-106)
Domains in SCOPe 2.08: d5y02a_
Chain 'B':
Compound: hydroxynitrile lyase
Species: Passiflora edulis [TaxId:78168]
Gene: PeHNL
Database cross-references and differences (RAF-indexed):
- Uniprot A0A1L7NZN4 (Start-106)
Domains in SCOPe 2.08: d5y02b_
Chain 'C':
Compound: hydroxynitrile lyase
Species: Passiflora edulis [TaxId:78168]
Gene: PeHNL
Database cross-references and differences (RAF-indexed):
- Uniprot A0A1L7NZN4 (1-106)
  - expression tag (0)
Domains in SCOPe 2.08: d5y02c1, d5y02c2
Chain 'D':
Compound: hydroxynitrile lyase
Species: Passiflora edulis [TaxId:78168]
Gene: PeHNL
Database cross-references and differences (RAF-indexed):
- Uniprot A0A1L7NZN4 (Start-106)
Domains in SCOPe 2.08: d5y02d_
Chain 'E':
Compound: hydroxynitrile lyase
Species: Passiflora edulis [TaxId:78168]
Gene: PeHNL
Database cross-references and differences (RAF-indexed):
- Uniprot A0A1L7NZN4 (Start-106)
Domains in SCOPe 2.08: d5y02e_
Chain 'F':
Compound: hydroxynitrile lyase
Species: Passiflora edulis [TaxId:78168]
Gene: PeHNL
Database cross-references and differences (RAF-indexed):
- Uniprot A0A1L7NZN4 (Start-106)
Domains in SCOPe 2.08: d5y02f_
Chain 'G':
Compound: hydroxynitrile lyase
Species: Passiflora edulis [TaxId:78168]
Gene: PeHNL
Database cross-references and differences (RAF-indexed):
- Uniprot A0A1L7NZN4 (Start-106)
Domains in SCOPe 2.08: d5y02g_
Chain 'H':
Compound: hydroxynitrile lyase
Species: Passiflora edulis [TaxId:78168]
Gene: PeHNL
Database cross-references and differences (RAF-indexed):
- Uniprot A0A1L7NZN4 (Start-106)
Domains in SCOPe 2.08: d5y02h_
Chain 'I':
Compound: hydroxynitrile lyase
Species: Passiflora edulis [TaxId:78168]
Gene: PeHNL
Database cross-references and differences (RAF-indexed):
- Uniprot A0A1L7NZN4 (Start-106)
Domains in SCOPe 2.08: d5y02i_
Chain 'J':
Compound: hydroxynitrile lyase
Species: Passiflora edulis [TaxId:78168]
Gene: PeHNL
Database cross-references and differences (RAF-indexed):
- Uniprot A0A1L7NZN4 (Start-106)
Domains in SCOPe 2.08: d5y02j_
Chain 'K':
Compound: hydroxynitrile lyase
Species: Passiflora edulis [TaxId:78168]
Gene: PeHNL
Database cross-references and differences (RAF-indexed):
- Uniprot A0A1L7NZN4 (Start-106)
Domains in SCOPe 2.08: d5y02k_
Chain 'L':
Compound: hydroxynitrile lyase
Species: Passiflora edulis [TaxId:78168]
Gene: PeHNL
Database cross-references and differences (RAF-indexed):
- Uniprot A0A1L7NZN4 (Start-106)
Domains in SCOPe 2.08: d5y02l_
Heterogens: MXN, HEZ, HBX, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>5y02A (A:)
gnppeivrhivfnryksqlsqkqidqiiadygnlqniapemkewkwgtdlgpavedradg
fthayestfhsvadflnffysppalefakeffpacekivvlnyiine