PDB entry 5xzu

View 5xzu on RCSB PDB site
Description: Crystal structure of GH10 xylanase from Bispora. sp MEY-1 with xylobiose
Class: hydrolase
Keywords: GH10 family, xylanase, HYDROLASE
Deposited on 2017-07-14, released 2018-05-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 1.7000000000000002 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-xylanase
    Species: Bispora sp. MEY-1 [TaxId:554688]
    Gene: xyl10C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xzua_
  • Chain 'B':
    Compound: Beta-xylanase
    Species: Bispora sp. MEY-1 [TaxId:554688]
    Gene: xyl10C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xzub_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xzuA (A:)
    wglnnaaradgklwfgtaadipgleqddryymkeynnthdfggttpanimkfmftepeqn
    vfnftgaqefldiafashklvrchnliwqselptwvtnpttnwtnetlskvlqnhvytlv
    shfgdqcyswdvvnealsddpagsyqnniwfdtigpeyvamafeyaekavkdhklnvkly
    yndynieypgpkstaaqnivkelkarniqidgvgleshfiagetpsqatqitnmadftsl
    didvavteldvrlylppnatseaqqvadyyatvaacaatercigitvwdfddtyswvpst
    fagqgyadlffqpdgpntplvkkaaydgclqalqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xzuA (A:)
    wglnnaaradgklwfgtaadipgleqddryymkeynnthdfggttpanimkfmftepeqn
    vfnftgaqefldiafashklvrchnliwqselptwvtnpttnwtnetlskvlqnhvytlv
    shfgdqcyswdvvnealsddpagsyqnniwfdtigpeyvamafeyaekavkdhklnvkly
    yndynieypgpkstaaqnivkelkarniqidgvgleshfiagetpsqatqitnmadftsl
    didvavteldvrlylppnatseaqqvadyyatvaacaatercigitvwdfddtyswvpst
    fagqgyadlffqpdgpntplvkkaaydgclqalq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xzuB (B:)
    wglnnaaradgklwfgtaadipgleqddryymkeynnthdfggttpanimkfmftepeqn
    vfnftgaqefldiafashklvrchnliwqselptwvtnpttnwtnetlskvlqnhvytlv
    shfgdqcyswdvvnealsddpagsyqnniwfdtigpeyvamafeyaekavkdhklnvkly
    yndynieypgpkstaaqnivkelkarniqidgvgleshfiagetpsqatqitnmadftsl
    didvavteldvrlylppnatseaqqvadyyatvaacaatercigitvwdfddtyswvpst
    fagqgyadlffqpdgpntplvkkaaydgclqalqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xzuB (B:)
    wglnnaaradgklwfgtaadipgleqddryymkeynnthdfggttpanimkfmftepeqn
    vfnftgaqefldiafashklvrchnliwqselptwvtnpttnwtnetlskvlqnhvytlv
    shfgdqcyswdvvnealsddpagsyqnniwfdtigpeyvamafeyaekavkdhklnvkly
    yndynieypgpkstaaqnivkelkarniqidgvgleshfiagetpsqatqitnmadftsl
    didvavteldvrlylppnatseaqqvadyyatvaacaatercigitvwdfddtyswvpst
    fagqgyadlffqpdgpntplvkkaaydgclqal