PDB entry 5xzr

View 5xzr on RCSB PDB site
Description: The atomic structure of SHP2 E76A mutant in complex with allosteric inhibitor 9b
Class: hydrolase
Keywords: phosphatase, SH2 domain, allosteric inhibitor, cancer, SIGNALING PROTEIN, HYDROLASE
Deposited on 2017-07-13, released 2017-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124 (23-556)
      • engineered mutation (98)
    Domains in SCOPe 2.07: d5xzra1, d5xzra2, d5xzra3
  • Heterogens: 8J6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xzrA (A:)
    mgsshhhhhhssglvprgshmasmtsrrwfhpnitgveaenllltrgvdgsflarpsksn
    pgdftlsvrrngavthikiqntgdyydlyggekfatlaalvqyymehhgqlkekngdvie
    lkyplncadptserwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddk
    gesndgkskvthvmircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqpln
    ttrinaaeiesrvrelsklaettdkvkqgfweefetlqqqeckllysrkegqrqenknkn
    ryknilpfdhtrvvlhdgdpnepvsdyinaniimpefetkcnnskpkksyiatqgclqnt
    vndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdyt
    lrelklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvv
    hcsagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiyma
    vqhyietlqrrieeeqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xzrA (A:)
    mtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntg
    dyydlyggekfatlaalvqyymehhgqlkekngdvielkyplncadptserwfhghlsgk
    eaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqelkyd
    vgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklaekv
    kqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdpnepvsd
    yinaniimpksyiatqgclqntvndfwrmvfqensrvivmttkevergkskcvkywpdey
    alkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyhfrtwpdhgvpsdpggv
    ldfleevhhkqesimdagpvvvhcsagigrtgtfividilidiirekgvdcdidvpktiq
    mvrsqrsgmvqteaqyrfiymavqhyietlqrrieeeqk