PDB entry 5xzi

View 5xzi on RCSB PDB site
Description: Crystal structure of the Zn-directed tetramer of the engineered cyt cb562 variant, AB5
Class: electron transport
Keywords: de novo protein, ELECTRON TRANSPORT
Deposited on 2017-07-12, released 2017-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40-41)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (76)
      • engineered mutation (85)
      • engineered mutation (88)
      • engineered mutation (92)
      • engineered mutation (95)
      • engineered mutation (97)
      • engineered mutation (99-100)
    Domains in SCOPe 2.07: d5xzia_
  • Heterogens: HEM, ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xziA (A:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkdaqeaaehlkctcnhchqkyr